DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp4f6

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_006241111.1 Gene:Cyp4f6 / 266689 RGDID:708365 Length:538 Species:Rattus norvegicus


Alignment Length:540 Identity:134/540 - (24%)
Similarity:223/540 - (41%) Gaps:113/540 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HLNIALWACGALLAVLLAWQQR---KCWRLIWQLNGWRGVIQQP-VLWLLLCINLHPNSILEKVS 62
            || :.|.....:||.:|||...   .|.||       |...|.| ..|....:.|..|:  |:..
  Rat    21 HL-LLLGGASWILARILAWIYTFYDNCCRL-------RCFPQPPKPSWFWGHLTLMKNN--EEGM 75

  Fly    63 QYRVHFQR--------------PLAVLVGTRVLLYIDDPAGMECVLNAPECLD-----KTFLQDG 108
            |:..|..|              |:..||...|:.    |........||:.:.     |.:|.| 
  Rat    76 QFIAHLGRNFRDIHLSWVGPVYPILRLVHPNVIA----PLLQASAAVAPKEMTLYGFLKPWLGD- 135

  Fly   109 FFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAA 173
                 |||.:.|:||...|:.|.|||..:|:.|:..:||...|.|..::|..|      .|.:|.
  Rat   136 -----GLLMSAGEKWNHHRRLLTPAFHFDILKSYVKIFNKSVNTMHAKWQRLT------AKGSAR 189

  Fly   174 EDLLSRAVLEVSCLT-------IMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVK----PWLQIR 227
            .|:..    .:|.:|       |....:|..:.:..:||    .:||:|:: :||    |:|.:.
  Rat   190 LDMFE----HISLMTLDSLQKCIFSFDSNCQESNSEYIA----AILELSSL-IVKRQRQPFLYLD 245

  Fly   228 LLHRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGE--DASNGWQRRIFIEQ 290
            .|:.|.|..  ...:|...::.:|...::|.:      |..:..:...|  .|....:...||:.
  Rat   246 FLYYLTADG--RRFRKACDVVHNFTDAVIRER------RSTLNTQGVDEFLKARAKTKTLDFIDV 302

  Fly   291 IFQLAANGE----MTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVP 351
            :  |.|..|    ::..:|..||.:.:....:|.::::...|..||.:. :.|.|...|:|.|:.
  Rat   303 L--LLAKDEHGKGLSDVDIRAEADTFMFGGHDTTASALSWILYNLARHP-EYQERCRQEVRELLR 364

  Fly   352 D--VGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLA-GRQHETIVPQNSIVVLDT 413
            |  ..::..:.|.||.:|...:.|||||...|.:..|..|:|..|. ||    ::|:.:|.|:..
  Rat   365 DREPEEIEWDDLAQLPFLTMCIKESLRLHPPVLLISRCCSQDIVLPDGR----VIPKGNICVISI 425

  Fly   414 FNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCI 478
            |.:..:...| .:...::|.|| |.|..|                  :|...:|:|||.|.|:||
  Rat   426 FGVHHNPSVW-PDPEVYNPFRF-DPENPQ------------------KRSPLAFIPFSAGPRNCI 470

  Fly   479 GRRYGLFIMKVFLVKLITNF 498
            |:.:.:..:||.|...:..|
  Rat   471 GQTFAMSEIKVALALTLLRF 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 121/497 (24%)
Cyp4f6XP_006241111.1 p450 53..515 CDD:278495 122/500 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.