DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp19a1

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_058781.2 Gene:Cyp19a1 / 25147 RGDID:2457 Length:503 Species:Rattus norvegicus


Alignment Length:481 Identity:101/481 - (20%)
Similarity:184/481 - (38%) Gaps:130/481 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LLCINLHPNSIL--EKVSQYRVHFQRP--LAVLVGTRVLLYIDDPAGMECVLNAPECLDKTFLQD 107
            |.||.:|.|.|:  ...|.:|.  .||  :..|.|..::..::     .||.:..:.||      
  Rat   122 LQCIGMHENGIIFNNNPSLWRT--VRPFFMKALTGPGLIRMVE-----VCVESIKQHLD------ 173

  Fly   108 GFFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTA 172
                |.|                             ||.::.|                   :..
  Rat   174 ----RLG-----------------------------DVTDNSG-------------------YVD 186

  Fly   173 AEDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLLHRLLAPEL 237
            ...|:...:|:.|....:|.|     ||::.|....:.........::||.:..::      ..|
  Rat   187 VVTLMRHIMLDTSNTLFLGIP-----LDESSIVKKIQGYFNAWQALLIKPNIFFKI------SWL 240

  Fly   238 YEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLAANGEMTL 302
            |.:.::..|.|:|.:..:|..|      |..|...:..||..:.....||.|:      .|::|.
  Rat   241 YRKYERSVKDLKDEIEILVEKK------RQKVSSAEKLEDCMDFATDLIFAER------RGDLTK 293

  Fly   303 EEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQVGLEQLQQLRYL 367
            |.:......|::.:.:|:|.::.:.||.:| ...:.:..:|.||..:|.| ..:.:..:|.|:.:
  Rat   294 ENVNQCILEMLIAAPDTMSVTLYVMLLLIA-EYPEVETAILKEIHTVVGD-RDIRIGDVQNLKVV 356

  Fly   368 DAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDP 432
            :.|::||||....|.:.:|....|..:.|..    |.:.:.::|:...|.|.|.:...|  :|..
  Rat   357 ENFINESLRYQPVVDLVMRRALEDDVIDGYP----VKKGTNIILNIGRMHRLEYFPKPN--EFTL 415

  Fly   433 QRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITN 497
            :.|                      :::..:.| |.||..|.|||.|:...:.:|||.||.|:..
  Rat   416 ENF----------------------EKNVPYRY-FQPFGFGPRSCAGKYIAMVMMKVVLVTLLKR 457

  Fly   498 FDFQSDFELEKLQFVENISLKFKNAD 523
            |..::   |:| :.:||:.   ||.|
  Rat   458 FHVKT---LQK-RCIENMP---KNND 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 94/459 (20%)
Cyp19a1NP_058781.2 CYP19A1 72..485 CDD:410709 101/481 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.