DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_663708.1 Gene:Cyp4x1 / 246767 RGDID:628719 Length:507 Species:Rattus norvegicus


Alignment Length:521 Identity:126/521 - (24%)
Similarity:221/521 - (42%) Gaps:76/521 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LNIALWACGALL---AVLLAWQQRKCWRLIWQLNGWRGVIQQPVLWLLLCINLHPNSILEKVSQY 64
            |::||..|.||:   ||.|..:::   ||:..|..:.|....   |||..........:||:.:.
  Rat    14 LHLALVFCLALVLMQAVKLYLRRQ---RLLRDLRPFPGPTAH---WLLGHQKFLQEDNMEKLDEI 72

  Fly    65 RVHFQRPLAVLVGT-RVLLYIDDPAGMECVLNAPECLDKT-FLQDGF--FVRRGLLHARGQKWKL 125
            ...:.......||. :...||.||...:..|:..:  .|| :|....  |:.||||:..|.:|..
  Rat    73 VKEYPCAFPCWVGPFQAFFYIYDPDYAKIFLSRTD--PKTQYLHQLMTPFLGRGLLNLDGPRWFQ 135

  Fly   126 RRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSCLTIM 190
            .|..|.|||..:|:....|:.....|.|:::::.........::.....:|::   |::......
  Rat   136 HRCLLTPAFHQDILKPCVDMMAHSVNMMLDKWEKTWTTQETTIEVFEHINLMT---LDIIMKCAF 197

  Fly   191 GTPTNFTQLDDAHIAHSYKR----LLEISAVRVVKPWLQIRLLHRLLAP------ELYEESKKCA 245
            |..|| .|::..:  .||.:    |.||.:.|:...|....::.: |:|      ||.:...:|.
  Rat   198 GQETN-CQINGTY--ESYVKATFELGEIISSRLYNFWHHHDIIFK-LSPKGHCFQELGKVIHQCT 258

  Fly   246 -KLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLAANGEMTLE--EIMD 307
             |:::|          |...|:|.|..:.: :.:.|      |::.:....|..|....  ::..
  Rat   259 EKIIQD----------RKKTLKDQVNQDDT-QTSQN------FLDIVLSAQAGDEKAFSDADLRS 306

  Fly   308 EAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQVGLEQLQQLRYLDAFVS 372
            |..:.:....:..:.||...|.|||.|. :.|.|...|||:::.|...:..|||.::.|....:.
  Rat   307 EVNTFMWAGHDASAASISWLLYCLALNP-EHQDRCRTEIRSILGDGSSITWEQLDEIPYTTMCIK 370

  Fly   373 ESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLD 437
            |:|||:..:|...|.:|:...|.....   :|....|||..:.:..:...| .:.:.|||.||..
  Rat   371 ETLRLIPPIPSISRELSKPLTLPDGHS---LPAGMTVVLSIWGLHHNPAVW-KDPKVFDPLRFTK 431

  Fly   438 QEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQS 502
            :..||                   ||..:|||||:|.|:|||:::.:..:||.:...:..|...:
  Rat   432 ENSEQ-------------------RHPCAFLPFSSGPRNCIGQQFAMLELKVAIALTLLRFRVAA 477

  Fly   503 D 503
            |
  Rat   478 D 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 112/477 (23%)
Cyp4x1NP_663708.1 CYP4B-like 66..500 CDD:410771 110/463 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.