DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp12d1-p

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001286304.1 Gene:Cyp12d1-p / 246648 FlyBaseID:FBgn0050489 Length:521 Species:Drosophila melanogaster


Alignment Length:484 Identity:106/484 - (21%)
Similarity:191/484 - (39%) Gaps:128/484 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LDKTFLQDGFFVRR----------------------GLLHARGQKWKLRRKQLNPAFSH-NIVAS 141
            ::..|..:|.:.||                      ||:.::.:.|...|..:||.|.. ..:..
  Fly   103 IEMVFRNEGIWPRRDGLDSIVYFREHVRPDVYGEVQGLVASQNEAWGKLRSAINPIFMQPRGLRM 167

  Fly   142 FFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAH 206
            :::..:::.|:.:|:.                :::.....|||        |.:||.        
  Fly   168 YYEPLSNINNEFIERI----------------KEIRDPKTLEV--------PEDFTD-------- 200

  Fly   207 SYKRLLEISAVRVVKPWLQIRLLHRLL-----------APELYEESKKCAKL-----LEDFVGGI 255
                  |||  |:|...|.:....|.:           |..|::.|:...:|     ::..:..|
  Fly   201 ------EIS--RLVFESLGLVAFDRQMGLIRKNRDNSDALTLFQTSRDIFRLTFKLDIQPSMWKI 257

  Fly   256 VRT-KHRNWR--LRDAVGGE----KSGEDASNGWQRRIFIEQIFQLAANGEMTLEEIMD-EAQSM 312
            :.| .:|..:  |.|::...    |..:||..  :||...|:|     |....||.:|: :.:..
  Fly   258 ISTPTYRKMKRTLNDSLNVAQKMLKENQDALE--KRRQAGEKI-----NSNSMLERLMEIDPKVA 315

  Fly   313 VLVSF-------ETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQ-VGLEQLQQLRYLDA 369
            |::|.       :..:..:...||||:.:. |.|.:|..|:.:::|.... :..|.::.:.||.|
  Fly   316 VIMSLDILFAGVDATATLLSAVLLCLSKHP-DKQAKLREELLSIMPTKDSLLNEENMKDMPYLRA 379

  Fly   370 FVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQR 434
            .:.|:||........:|....|..|:|.:    ||:.:.|:|.: |:...|..:.....:|.|:|
  Fly   380 VIKETLRYYPNGLGTMRTCQNDVILSGYR----VPKGTTVLLGS-NVLMKEATYYPRPDEFLPER 439

  Fly   435 FLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNF- 498
            :|           .|..:|:|.:.    ..::||||..|.|.|||:|.....|:..:.|||.|| 
  Fly   440 WL-----------RDPETGKKMQV----SPFTFLPFGFGPRMCIGKRVVDLEMETTVAKLIRNFH 489

  Fly   499 -DFQSDFELE-KLQFVEN--ISLKFKNAD 523
             :|..|.... |..||..  |:..||..|
  Fly   490 VEFNRDASRPFKTMFVMEPAITFPFKFTD 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 98/459 (21%)
Cyp12d1-pNP_001286304.1 p450 70..508 CDD:299894 102/472 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442758
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.