DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp4a29

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001093653.1 Gene:Cyp4a29 / 230639 MGIID:3717143 Length:509 Species:Mus musculus


Alignment Length:547 Identity:116/547 - (21%)
Similarity:222/547 - (40%) Gaps:101/547 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LWACGALLAVLLAWQQ--RKCW--RLIWQL----NGW------RGVIQQPVLWLLLCINLHPNSI 57
            ::..|.||.:..|.|.  |:.|  |.::|.    :.|      :..:.:.:.|:|..:...|.:.
Mouse    22 IFLIGLLLLLFKAAQHYLRRQWLLRALYQFPSPPSHWLFGHCLQFKVDEELRWILRYLEKFPGAF 86

  Fly    58 LEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNA--PECLDKTFLQDGFFVRRGLLHARG 120
            |        |:      :.|:.|.:.:.||..|:.:|..  |:.....||..  ::..||....|
Mouse    87 L--------HW------IWGSHVFIKVCDPDYMKVILGRADPKASLYRFLTP--WLGHGLFFLNG 135

  Fly   121 QKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVS 185
            .:|...|:.|.|||.::|:..:..:.......|:|:::.           .|.:|:.......:|
Mouse   136 DEWFQHRRLLTPAFHYDILKPYVGIMADSVQVMLEKWEQ-----------IACQDITLEIFHPIS 189

  Fly   186 CL---TIMGTPTNF---TQLDDAHIAHSYKRLLEISAVRVVKPWLQIRL----LHRLLAPELYEE 240
            .:   |||....::   .|||.:..|:       :.||..:...:..|:    ||..:...|...
Mouse   190 LMMLDTIMKYAFSYQGSVQLDRSSQAY-------LQAVSDLNNLVTSRMKNVFLHNDIIYNLTSH 247

  Fly   241 SKK---CAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIF--QLAANGEM 300
            |::   ..::..:....:|  |.|..:|:|....:|     ..|.:...|::.:.  ::.....:
Mouse   248 SRRTNSACQIAHEHTDRVV--KLRKAQLQDNKSMKK-----LRGKRCLDFLDILLLSRMDDGSSL 305

  Fly   301 TLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQVGLEQLQQLR 365
            :.:.:..|..|::....:|.::.|......|||:. |.|:|...|:::|:.|...:..:.|.|:.
Mouse   306 SDKALRAEVDSLMFGGHDTPASGISWVFYALATHP-DHQQRCREEVQSLLGDGSPITWDHLHQMP 369

  Fly   366 YLDAFVSESLRLLATVPMNLRHVSRDFRLA-GRQHETIVPQNSIVVLDTFNMQRDERWWGANARQ 429
            |....:.|:|||...:|...|.:|...... ||.    :|:...|:|..:.:..:.:.| .|...
Mouse   370 YTTMCIKEALRLYPPIPSVGRKLSTPVTFPDGRS----LPKGITVLLHFYALHHNPKVW-PNPEV 429

  Fly   430 FDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKL 494
            |||.||                     .....:||::|||||.|.|:|||:...:.::||.:...
Mouse   430 FDPSRF---------------------AMNSVQHSHAFLPFSGGSRNCIGKHLAMNVLKVAVALT 473

  Fly   495 ITNFDFQSDFELEKLQFVENISLKFKN 521
            :..|:...|.....:. .:.:.||.||
Mouse   474 LLRFELLPDPSRVPIP-TQQLVLKSKN 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 101/478 (21%)
Cyp4a29NP_001093653.1 p450 52..503 CDD:278495 107/517 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.