DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and cyp-29A3

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_503130.2 Gene:cyp-29A3 / 189649 WormBaseID:WBGene00021412 Length:503 Species:Caenorhabditis elegans


Alignment Length:408 Identity:99/408 - (24%)
Similarity:174/408 - (42%) Gaps:79/408 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAED---- 175
            ||...|::|:..||.|.|.|....:..:|:|||:....:|:...          ||..:.:    
 Worm   124 LLEGYGERWRSHRKMLTPTFHFAKLEGYFEVFNTESRVVVDCLD----------KFAKSGETVDL 178

  Fly   176 --LLSRAVLEVSCLTIMGTPTNFTQLDDAH-IAHSYKRLLEISAVRVVKPWLQIRLLHRLLAPEL 237
              ...|..|:..|.|.||...: .||.::| ...:.::.|::..:..:.|..||        |.:
 Worm   179 FPFFKRCTLDTICKTAMGAKVD-AQLQNSHPYITAIEQALQLGVLYAMNPHHQI--------PAI 234

  Fly   238 Y----EESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRI-FIEQIFQLAAN 297
            |    .:.||      |....|::|..|| .:.:.....:|||......:|.: |::.:.....:
 Worm   235 YWALGHQKKK------DEYFNIMKTFTRN-VIAERRTARESGEVEKETSKRNMNFLDILLSNEES 292

  Fly   298 GEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQ-----VG 357
            ..::.|::..|..:.:....:|.:.|:......|| :..|.|:.:..||   |...|:     |.
 Worm   293 SVLSPEDLRQEVDTFMFAGHDTTTTSVSWVCWNLA-HHPDIQQNVYEEI---VSVFGEDPNEDVT 353

  Fly   358 LEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERW 422
            .|.:::|.|.:..:.||.|:..|||..||.:..|..:.|    .::|..:.|.:....:.::   
 Worm   354 TEGIKKLEYTERMLKESKRICPTVPAVLRQLISDMEIGG----VLIPAGANVAIAPMAIHKN--- 411

  Fly   423 WGANARQ----FDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYG 483
              ||..|    |||.|||.:|..                   :||:|.|:|||.|||:|||:::.
 Worm   412 --ANIYQNPDIFDPDRFLPEETA-------------------KRHAYDFIPFSAGLRNCIGQKFA 455

  Fly   484 LFIMKVFLVKLITNFDFQ 501
            ....||.::.|:.||..:
 Worm   456 QLNEKVMVIHLLKNFKIE 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 99/408 (24%)
cyp-29A3NP_503130.2 p450 37..477 CDD:278495 99/408 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.