DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP4B1

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001093242.1 Gene:CYP4B1 / 1580 HGNCID:2644 Length:512 Species:Homo sapiens


Alignment Length:536 Identity:124/536 - (23%)
Similarity:217/536 - (40%) Gaps:103/536 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NIALWACGALLAV-------LLAWQQRKCWRLIWQLNGWRGVIQQPVLWLL-LCINLHPNSILEK 60
            ::.|||.|.:|.:       ||..:|    .|...::.:.|   .|..||. ..:.:.....|:|
Human    12 SLGLWASGLILVLGFLKLIHLLLRRQ----TLAKAMDKFPG---PPTHWLFGHALEIQETGSLDK 69

  Fly    61 VSQYRVHFQRPLAVLVGTRV-LLYIDDPAGMECVLN-----APECLDKTFLQDGFFVRRGLLHAR 119
            |..:...|.....:..|..: .|.|.:|...:.|.:     ||:..| .|||   ::.||||...
Human    70 VVSWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYD-FFLQ---WIGRGLLVLE 130

  Fly   120 GQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQA------VKFTAAEDLLS 178
            |.||...||.|.|.|.::::..:..||......|:::::.:.. .|::      |...|...|: 
Human   131 GPKWLQHRKLLTPGFHYDVLKPYVAVFTESTRIMLDKWEEKAR-EGKSFDIFCDVGHMALNTLM- 193

  Fly   179 RAVLEVSCLTIMGTPTNFTQLDDAHIAHS--YKRLLEISAVRVVKPWLQIRLL----HR----LL 233
                  .|....|         |..:.||  ....|.:|.:.::   :|.||:    |.    .|
Human   194 ------KCTFGRG---------DTGLGHSRDSSYYLAVSDLTLL---MQQRLVSFQYHNDFIYWL 240

  Fly   234 APELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRI-FIEQIFQLAAN 297
            .|......:.| ::..|....::|.:      :.|:..||..:...|  :|.: |::.:  |.|.
Human   241 TPHGRRFLRAC-QVAHDHTDQVIRER------KAALQDEKVRKKIQN--RRHLDFLDIL--LGAR 294

  Fly   298 GEMTLE----EIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQVGL 358
            .|..::    ::..|..:.:....:|.::.|...|.|:|... :.|.|...|:|.::.|......
Human   295 DEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYP-EHQHRCREEVREILGDQDFFQW 358

  Fly   359 EQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLA-GRQHETIVPQNSIVVLDTFNMQRDERW 422
            :.|.::.||...:.||.||...||...|.:|:..... ||.    :|..|::.:..:.:.|:...
Human   359 DDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRS----LPAGSLISMHIYALHRNSAV 419

  Fly   423 WGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIM 487
            | .:...||..||   ..|..||                ||.::|:|||.|.|:|||:::.:..|
Human   420 W-PDPEVFDSLRF---STENASK----------------RHPFAFMPFSAGPRNCIGQQFAMSEM 464

  Fly   488 KVFLVKLITNFDFQSD 503
            ||.....:..|:|..|
Human   465 KVVTAMCLLRFEFSLD 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 113/489 (23%)
CYP4B1NP_001093242.1 p450 47..501 CDD:306555 115/497 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.