DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP4A11

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens


Alignment Length:563 Identity:119/563 - (21%)
Similarity:202/563 - (35%) Gaps:137/563 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GVIQQPVLWLLLC-------INLHPNSILEKVSQYRV--------HFQR---------------- 70
            |::|...|.:||.       :.||...:|:.:.|:..        |.|.                
Human    17 GILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRIQKWVET 81

  Fly    71 -PLAV---LVGTRVLLYIDDPAGMECVLNAPECLDKT-----FLQDGFFVRRGLLHARGQKWKLR 126
             |.|.   |.|.:|.:.:.||..|:.:|...:  .|:     ||..  ::..|||...||.|...
Human    82 FPSACPHWLWGGKVRVQLYDPDYMKVILGRSD--PKSHGSYRFLAP--WIGYGLLLLNGQTWFQH 142

  Fly   127 RKQLNPAFSHNIVASF------------------------FDVFNSVGNQMVEQFQTQTNLHGQA 167
            |:.|.|||.::|:..:                        .:||..|....::........|..:
Human   143 RRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFSHQGS 207

  Fly   168 VKFTAAEDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLLHRL 232
            ::.........:|:.:::.|........|.|.|..:...|..|            |     .|| 
Human   208 IQVDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGR------------W-----THR- 254

  Fly   233 LAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLA-- 295
                       ..:|.......:::.:....        :|.||......:|.:....|..||  
Human   255 -----------ACQLAHQHTDQVIQLRKAQL--------QKEGELEKIKRKRHLDFLDILLLAKM 300

  Fly   296 ANGE-MTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQVGLE 359
            .||. ::.:::..|..:.:....:|.::.|...|..|||:... |.|...||.:|:.|...:...
Human   301 ENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKH-QERCREEIHSLLGDGASITWN 364

  Fly   360 QLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLA-GRQHETIVPQNSIVVLDTFNMQRDERWW 423
            .|.|:.|....:.|:|||...||...|.:|...... ||.    :|:..:|:|..:.:..:.:.|
Human   365 HLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRS----LPKGIMVLLSIYGLHHNPKVW 425

  Fly   424 GANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMK 488
             .|...|||.||.             .||.:        ||::|||||.|.|:|||:::.:..:|
Human   426 -PNPEVFDPFRFA-------------PGSAQ--------HSHAFLPFSGGSRNCIGKQFAMNELK 468

  Fly   489 VFLVKLITNFDFQSDFELEKLQFVENISLKFKNADDILLTIQP 531
            |.....:..|:...|.....:. :..:.||.||...:.|...|
Human   469 VATALTLLRFELLPDPTRIPIP-IARLVLKSKNGIHLRLRRLP 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 110/528 (21%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 108/521 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.