DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus


Alignment Length:576 Identity:133/576 - (23%)
Similarity:224/576 - (38%) Gaps:133/576 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IALWACGALLAVL------LAWQQRKCWRLIWQLNGWRGVIQQPVLWLL-LCINLHPNSILEKVS 62
            :.|||...:|.|.      |.::::|..|.:....|      .|..||. ..:.:.....|:||.
Mouse    13 LGLWASVVILMVTVLKLLSLLFRRQKLARALDSFPG------PPKHWLFGHALEIQKTGGLDKVV 71

  Fly    63 QYRVHFQRPLAVLVGT-RVLLYIDDPAGMECVLNA--PECLDKTFLQDGF--FVRRGLLHARGQK 122
            .:...|.....:.:|. .|.|.|.:|...:.|.:.  |:.   .::.|.|  ::.:|||...|.|
Mouse    72 TWTEQFPYAHPLWLGQFIVFLNIYEPDYAKAVYSRGDPKA---AYVYDFFLQWIGKGLLVLEGPK 133

  Fly   123 WKLRRKQLNPAFSHNI----VASF--------------------FDVFNSVGNQMVEQFQTQTNL 163
            |...||.|.|.|.:::    ||.|                    ||:|..||:..::.....|  
Mouse   134 WFQHRKLLTPGFHYDVLKPYVAIFAESTRVMLDKWEKKASENKSFDIFCDVGHMALDTLMKCT-- 196

  Fly   164 HGQAVKFTAAEDLLSRA----VLEVSCLTIMGTPTNFTQLDDAHIAHS---YKRLLEISAVRVVK 221
                  |...:..||.:    .|.||.||::     ..|..|:...|:   |             
Mouse   197 ------FGKGDSGLSHSDNSYYLAVSDLTLL-----MQQRIDSFQYHNDFIY------------- 237

  Fly   222 PWLQIRLLHRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRI 286
             |         |.|......:.| ::..|....::|  .|...|:|....:|..|      :|.:
Mouse   238 -W---------LTPHGRRFLRAC-QIAHDHTDHVIR--QRKAALQDEKEQKKLQE------RRHL 283

  Fly   287 -FIEQIFQLAANGEMTLE----EIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEI 346
             |::.:  |.|..|..::    ::..|..:.:....:|.::.|...|.|:|..... |:|...|:
Mouse   284 DFLDIL--LGARDESGIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPMH-QQRCREEV 345

  Fly   347 RALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLA-GRQHETIVPQNSIVV 410
            |.::.|......:.|.|:.||...:.|..||...||...|.:|:..... ||.    :|..|::.
Mouse   346 REILGDRDSFQWDDLAQMTYLTMCMKECFRLYPPVPQVYRQLSKPVTFVDGRS----LPAGSLIS 406

  Fly   411 LDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLR 475
            |..:.:.|:...| .:...|||.||..:         |.:|          ||.::|:|||.|.|
Mouse   407 LHIYALHRNSAVW-PDPEVFDPLRFSPE---------NMTG----------RHPFAFMPFSAGPR 451

  Fly   476 SCIGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQFVENISLKFKNADDILLTIQP 531
            :|||:::.:..|||.....:..|:|..|.....:: |..:.|:.||.  |.|.::|
Mouse   452 NCIGQQFAMNEMKVVTALCLLRFEFSPDPSKIPIK-VPQLILRSKNG--IHLYLKP 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 116/503 (23%)
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 123/536 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.