DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and CYP4F22

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_775754.2 Gene:CYP4F22 / 126410 HGNCID:26820 Length:531 Species:Homo sapiens


Alignment Length:519 Identity:116/519 - (22%)
Similarity:217/519 - (41%) Gaps:113/519 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WRGVIQQPVLWLLLCINLHPNSILEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNAPEC 99
            |.|    |||.||:.:  ||:.|            :|   |:|....:             ||: 
Human    99 WMG----PVLPLLVLV--HPDYI------------KP---LLGASAAI-------------APK- 128

  Fly   100 LDKTFLQDGF---FVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQT 161
             |..|.  ||   ::..|||.::|.||...|:.|.|||..:|:..:..:||...:.|..:::...
Human   129 -DDLFY--GFLKPWLGDGLLLSKGDKWSRHRRLLTPAFHFDILKPYMKIFNQSADIMHAKWRHLA 190

  Fly   162 NLHGQAVKFTAAE-------DLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRV 219
              .|.||.....|       |.|.:.|...:        :|..:....:|:    .::|:||:.|
Human   191 --EGSAVSLDMFEHISLMTLDSLQKCVFSYN--------SNCQEKMSDYIS----AIIELSALSV 241

  Fly   220 VKPWLQIRLLHRLLAPELYEES------KKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDA 278
            .:   |.||.|.|  ..:|..|      ::...::..|...:::.:.|..|.:.|....|:.:..
Human   242 RR---QYRLHHYL--DFIYYRSADGRRFRQACDMVHHFTTEVIQERRRALRQQGAEAWLKAKQGK 301

  Fly   279 SNGWQRRIFIEQIFQLAAN---GEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQR 340
            :..     ||: :..||.:   .|::.|:|..||.:.:....:|.|:.|...|..|| ...:.|.
Human   302 TLD-----FID-VLLLARDEDGKELSDEDIRAEADTFMFEGHDTTSSGISWMLFNLA-KYPEYQE 359

  Fly   341 RLLAEIRALVP--DVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLA-GRQHETI 402
            :...||:.::.  ::.::..:.|.||.:....:.||||....|.:..|..:.|.:|. ||    |
Human   360 KCREEIQEVMKGRELEELEWDDLTQLPFTTMCIKESLRQYPPVTLVSRQCTEDIKLPDGR----I 420

  Fly   403 VPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSF 467
            :|:..|.::..:....:...| .:::.::|.|| |.:..|                  :|...::
Human   421 IPKGIICLVSIYGTHHNPTVW-PDSKVYNPYRF-DPDNPQ------------------QRSPLAY 465

  Fly   468 LPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQFVENISLKFKNADDILLTIQP 531
            :|||.|.|:|||:.:.:..::|.:...:..|....| ...|::....:.|:.:|.  :.|.::|
Human   466 VPFSAGPRNCIGQSFAMAELRVVVALTLLRFRLSVD-RTRKVRRKPELILRTENG--LWLKVEP 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 108/482 (22%)
CYP4F22NP_775754.2 p450 60..524 CDD:278495 115/515 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.