DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and XB5864179

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_002931495.3 Gene:XB5864179 / 100488386 XenbaseID:XB-GENE-5864180 Length:519 Species:Xenopus tropicalis


Alignment Length:546 Identity:121/546 - (22%)
Similarity:217/546 - (39%) Gaps:71/546 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ALWACGALLAVLLAWQQRKCWR--LIWQLNGWRGVIQQPVLWLLLCINLHPNSI--------LEK 60
            |.|.|  ||.||....|...||  |:...:.:.|.         .|..|:.|:.        |:.
 Frog    22 AAWLC--LLLVLYKAAQLYVWRRKLVAAFSPFPGP---------KCHWLYGNTYEFLQIGKDLDL 75

  Fly    61 VSQYRVHFQRPLAVLVGT-RVLLYIDDPAGMECVLNAPECLDK---TFLQDGFFVRRGLLHARGQ 121
            |..:...|...:.:.:|. ...|.|..|...:.||...:..|.   .|:..  ::..|||...|.
 Frog    76 VLGWAQVFPYGMPLWLGNFYATLIITHPDYAKAVLARQDPKDDMAYKFIVP--WIGEGLLVLSGP 138

  Fly   122 KWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSC 186
            ||...|:.|.|.|.::::..:..:.:.....|::::. :...:.::|:......|::...: :.|
 Frog   139 KWFQHRRLLTPGFHYDVLKPYVTLMSDCTRVMLDKWD-KLMPNEKSVELFHYVSLMTLDTI-MKC 201

  Fly   187 LTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLLHRLLAPELYEESKKCAKLLEDF 251
            .....|... ...|:|:|...|:....:.......|:....:.|  |:| |....:|........
 Frog   202 AFSYNTSCQ-NNRDNAYINAVYELSYLVDQRFRFFPYHNKLIFH--LSP-LGFRFRKALSTAHQH 262

  Fly   252 VGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLA--ANGE-MTLEEIMDEAQSMV 313
            ...::  |.|...|......:|..:      :|.:....|...|  .||: ::.|::..|..:.:
 Frog   263 TDKVI--KQRKESLMHETELDKIRQ------KRHLDFLDILLCAKDENGKGLSDEDLRAEVDTFM 319

  Fly   314 LVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQVGLEQLQQLRYLDAFVSESLRLL 378
            ....:|.::.|...|.|:| ...:.|::...||..|:.:...:|.:.|.::.|....:.|||||.
 Frog   320 FEGHDTTASGISWILYCIA-KYPEHQQKCREEITELLGERETMGWDDLGKIPYTTLCIKESLRLY 383

  Fly   379 ATVPMNLRHVSRDFRLA-GRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQ 442
            ..||...|.:|:..... ||.    :|:.:.::|..:::.|....| .:...|||.|||.:..  
 Frog   384 PPVPGIGRRLSKPITFCDGRS----LPEGASIILSIYSINRSPSLW-KDPEVFDPLRFLPENS-- 441

  Fly   443 LSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQSDFELE 507
                             |.||.::|||||.|.|:|||:.:.:..|||.:...:..::...|.:.|
 Frog   442 -----------------DNRHPHAFLPFSAGPRNCIGQNFAMNEMKVAVALTLQRYELFPDPDNE 489

  Fly   508 KLQFVENISLKFKNADDILLTIQPKK 533
            . |.|..|.|:..|...:.|....||
 Frog   490 P-QKVPQIVLRSLNGIHVKLRKIEKK 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 99/476 (21%)
XB5864179XP_002931495.3 CYP4B-like 73..507 CDD:410771 103/475 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.