DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and XB5810926

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_031756807.1 Gene:XB5810926 / 100488227 XenbaseID:XB-GENE-5810927 Length:516 Species:Xenopus tropicalis


Alignment Length:485 Identity:102/485 - (21%)
Similarity:194/485 - (40%) Gaps:97/485 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LYIDDPAGMECVLNAPECLDKT---FLQDGFFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFF 143
            |::..|...:.:|...|..|.|   :|..  ::.:|||...|.||...|:.|.|.|.::::..:.
 Frog    94 LFVTHPDYAKAILGRQEPKDDTAYKYLVP--WIGKGLLVLSGPKWFQHRRLLTPGFHYDVLKQYV 156

  Fly   144 DVFNSVGNQMVEQFQTQTNLHGQAVKFTAAE---DLLSRAVLEVSCLTIMGTPTNFTQLDDAHIA 205
            .:.:.....|::::.          |....|   :|.....| ::..|||....::......:..
 Frog   157 SLMSDCTRVMLDKWD----------KLMPNEKSIELFHHVSL-MTLDTIMKCAFSYNSSCQNNRD 210

  Fly   206 HSY-KRLLEISAVRVVKPWLQIRLLHRLLAPELYEES--------------------KKCAKLLE 249
            :.| |.:.|:|.:                   :||.|                    :|...:..
 Frog   211 NEYIKAVYELSYL-------------------VYERSSFFPYHNDVIFSLSPLGFRFRKALSIAH 256

  Fly   250 DFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRI-FIE-QIFQLAANGE-MTLEEIMDEAQS 311
            .....::  |||...|.:....:|..:      :|.: |:: .:|....||: ::.|::..|..:
 Frog   257 QHTDKVI--KHRKESLINETELDKISQ------KRHLDFLDILLFAKDENGKGLSDEDLRAEVDT 313

  Fly   312 MVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQVGLEQLQQLRYLDAFVSESLR 376
            .:....:|.::.|...|.|:| ...:.|::...||..|:.|...:....|.|:.|..:.:.||||
 Frog   314 FMFAGHDTTASGISWILYCIA-KYPEHQQKCREEITELLGDRETMEWGDLGQIPYTTSCIKESLR 377

  Fly   377 LLATVPMNLRHVSRDFRLA-GRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEE 440
            |...||:..|.:|:....: ||.    :|:.:.|:...:.:.|....| .:...|||.||..:..
 Frog   378 LYPPVPIIGRRLSKSITFSDGRS----LPEGTEVITSIYAINRSPSVW-KDPEVFDPSRFSPENS 437

  Fly   441 EQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQSDFE 505
                               |.||.::|:|||.|.|:|||:.:.:..|||.:...:..::...|.:
 Frog   438 -------------------DSRHPHAFIPFSAGPRNCIGQNFAMNEMKVVVALTLQRYELFPDPD 483

  Fly   506 LEKLQFVENISLKFKNADDILLTIQPKKES 535
             .|.|.|..|.|:..|..::.:....||::
 Frog   484 -NKPQKVPQIVLRSLNGINVKIRRVEKKKN 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 93/451 (21%)
XB5810926XP_031756807.1 CYP4B-like 69..503 CDD:410771 100/474 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.