DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp318a1 and cyp19a1

DIOPT Version :9

Sequence 1:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001090630.1 Gene:cyp19a1 / 100036594 XenbaseID:XB-GENE-953895 Length:500 Species:Xenopus tropicalis


Alignment Length:342 Identity:70/342 - (20%)
Similarity:143/342 - (41%) Gaps:54/342 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 VLEVSCLTIMGTPTNF---TQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLLHRLLAPELYEESK 242
            ||::..|.::.|..|.   ..||:..|....::..:.....::||.:..::      ..||::.:
 Frog   185 VLKLMRLIMLDTSNNLFLRIPLDENEIVLKIQKYFDAWQALLLKPDIFFKI------SWLYKKYE 243

  Fly   243 KCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLAANGEMTLEEIMD 307
            |.|..|::.:..::..|.:.     ....||..|:..       |..::.....:|::|.|.:..
 Frog   244 KSANDLKEAIEILIEQKRQK-----LSSSEKLDENMD-------FASELIFAQNHGDLTAENVNQ 296

  Fly   308 EAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQVGLEQLQQLRYLDAFVS 372
            ....|::.:.:|:|.|:...|:.:|.:. ..:..::.||..::.| ..|....:..|:.|:.|:.
 Frog   297 CILEMLIAAPDTMSVSLFFMLVLVAQHP-KIEEGIMNEIDNVIGD-RDVESNDIPNLKVLENFIY 359

  Fly   373 ESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLD 437
            ||:|....|.:.:|....|..:.|    ..|.:.:.::|:...|.|.|.:...|  :|..:.|  
 Frog   360 ESMRYQPVVDLVMRKALEDDMIDG----YYVKKGTNIILNLGRMHRIEYFPKPN--EFTLENF-- 416

  Fly   438 QEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQS 502
                                ::...:.| |.||.:|.|:|.|:...:.:|||.||.|...:..|:
 Frog   417 --------------------EKTVPYRY-FQPFGSGPRACAGKYIAMVMMKVILVTLFKRYKVQT 460

  Fly   503 --DFELEKLQFVENISL 517
              ...||.:|...::|:
 Frog   461 LGGRCLENIQNNNDLSM 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 66/326 (20%)
cyp19a1NP_001090630.1 p450 46..486 CDD:365848 70/342 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.