DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp311a1 and CYP96A8

DIOPT Version :9

Sequence 1:NP_572780.3 Gene:Cyp311a1 / 32170 FlyBaseID:FBgn0030367 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_175193.1 Gene:CYP96A8 / 841171 AraportID:AT1G47620 Length:520 Species:Arabidopsis thaliana


Alignment Length:544 Identity:112/544 - (20%)
Similarity:223/544 - (40%) Gaps:109/544 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLITLTIWILVRK-WTLLRLGSSLPG-PWAFPLLGNAQMVGKLRPEYIFLVFTELRDRFGATYRL 69
            |...::.:.||:| ::.|.:..:|.. ||.:|:||....| .||.:.|:....|:.:....|::.
plant    14 LCFLISFYFLVKKPFSYLLIKKTLQSYPWNWPVLGMLPGV-LLRLQRIYDCSVEVLENSNMTFQF 77

  Fly    70 RLGPQLWVF------------LHSAEETRQALHDPTLRKADTFMQLEPLIGNGLLISHGAHWTRQ 122
            : ||  |..            :|....:..:    ...|...|.::....|:|::.:....|...
plant    78 K-GP--WFVGMDVLATVDPANIHHIMSSNFS----NYIKGPIFHEIFEAFGDGIINTDAELWRDW 135

  Fly   123 RRLLTPAFQPQLLRSFAPA------------IGGHV--ERLVGRLGAT----------------- 156
            |......|..|..::|:.:            :..|.  |.:|..|...                 
plant   136 RNASQLIFNHQRYQNFSASTTKTKVNDGLVPLFNHFANEEIVVDLEDVFQRFMYDITFIFITGTD 200

  Fly   157 -RGAFLEVTEPLFACLLDAIVDTSMGAQLDTQSVDHSPIIQAFHLSSKLLFKRMINPLLSSDWIF 220
             |...:|:.|..|:..||.:.|          ::.|.      |::.:.::|             
plant   201 PRSLSIEMPEVEFSKALDDVGD----------AIVHR------HITPRFVWK------------- 236

  Fly   221 QRTQLWRDLDEQLQVI--HSQMESVIEK----RAKELLDMG---EPAGRAHNLLDTLL---LAKF 273
              .|.|..:..:.:::  |:..:.|.||    :.:||...|   ...|...:||.:.:   ..|:
plant   237 --LQKWIGIGTEKKMLKAHATFDRVCEKIIAAKREELGSQGITYNSNGEREDLLTSFIKLDATKY 299

  Fly   274 EGQSLSR-REIRDEINTFVFAGVDTTTAAMSFVLYALAKFPETQTRLRKELQDVALDETTDLDA- 336
            |....|. :.:||....|:.||.|:|.:.:::..:.|:|.|...|::.:|:........:|.|. 
plant   300 EVLKPSHDKFLRDFTIGFMAAGRDSTASTLTWFFWNLSKNPNVLTKILQEINTNLPRTGSDQDMS 364

  Fly   337 --LNGLPYLEALIKEVLRLYTIVPTTGRQTTQSTEI-GGRTYCAGVTLWINMYGLAHDKEYY-PD 397
              ||.|.||...:.|.:|||..:|...:...:...: .|....:.:.:.|.:|.:...|..: .|
plant   365 SYLNKLVYLHGALSESMRLYPPIPFQRKSPIKEDVLPSGHKVKSNINIMIFIYAMGRMKTIWGED 429

  Fly   398 PYAFKPERWLPEDGAVA-PPAFSYIPFSGGPHVCIGRRYSLLLMKLLTARLVREFQMELSPEQAP 461
            ...||||||:.|.|.|. .|::.::.|:.||..|:|:..::.|||.:...:::.:::::...|  
plant   430 AMEFKPERWISETGGVRHEPSYKFLSFNAGPRTCLGKNLAMNLMKTVIVEILQNYEIKIVSGQ-- 492

  Fly   462 LRLEAQ--MVLKAQQGINVSFLKQ 483
             ::|.:  ::|..:.|:.|:..|:
plant   493 -KIEPKPGLILHMKHGLKVTMTKK 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp311a1NP_572780.3 p450 30..480 CDD:278495 105/515 (20%)
CYP96A8NP_175193.1 p450 1..515 CDD:386267 111/542 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.