DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp311a1 and CYP86A1

DIOPT Version :9

Sequence 1:NP_572780.3 Gene:Cyp311a1 / 32170 FlyBaseID:FBgn0030367 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_200694.1 Gene:CYP86A1 / 836003 AraportID:AT5G58860 Length:513 Species:Arabidopsis thaliana


Alignment Length:455 Identity:108/455 - (23%)
Similarity:182/455 - (40%) Gaps:106/455 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GPQLWVFLHSAEETRQALHDPTLRKADTFMQLEPLIGNGLLISHGAHWTRQRRLLTPAFQPQLLR 136
            || :|         |.|.||              |:|.|:..|.|..|..||:.....|..:.||
plant   107 GP-MW---------RAAFHD--------------LLGQGIFNSDGDTWLMQRKTAALEFTTRTLR 147

  Fly   137 -SFAPAIGGHVERLVGRLGATRGAFLEVTEP-----LFACL-LDAIVDTSMGAQLDTQSVD--HS 192
             :.|..:.|.::   .||.......::..:|     ||..| .|.|...:.|...:|.|:|  .:
plant   148 QAMARWVNGTIK---NRLWLILDRAVQNNKPVDLQDLFLRLTFDNICGLTFGKDPETLSLDLPDN 209

  Fly   193 PIIQAFHLSSKLLFKRMINPLLSSDWIFQRTQLWR-----------DLDEQLQVIHSQMESVIEK 246
            |...||..:::...||    ||.:.:      |||           .|.:.|:|:.:.|...|:.
plant   210 PFSVAFDTATEATLKR----LLYTGF------LWRIQKAMGIGSEDKLKKSLEVVETYMNDAIDA 264

  Fly   247 RAKELLDMGEPAGRAHNLLDTLLLAKFEGQSLSRREIRDEI----------NTFVFAGVDTTTAA 301
            |.....|.              ||::|    |.:|::...:          ..||.||.||::.|
plant   265 RKNSPSDD--------------LLSRF----LKKRDVNGNVLPTDVLQRIALNFVLAGRDTSSVA 311

  Fly   302 MSFVLYALAKFPETQTRLRKEL-----------QDVALDETTDLDALNGLPYLEALIKEVLRLYT 355
            :|:..:.:....|.:|::..||           |:...:|..:.|..:.|.||:|.:.|.||||.
plant   312 LSWFFWLVMNNREVETKIVNELSMVLKETRGNDQEKWTEEPLEFDEADRLVYLKAALAETLRLYP 376

  Fly   356 IVPTTGRQTTQSTEIGGRTYC-AGVTLWINMYGLAHDKEYY-PDPYAFKPERWLPEDG---AVAP 415
            .||...:.......:...|:. .|.|:..::|.:...|..: .|...|:|||||..||   ....
plant   377 SVPQDFKYVVDDDVLPDGTFVPRGSTVTYSIYSIGRMKTIWGEDCLEFRPERWLTADGERFETPK 441

  Fly   416 PAFSYIPFSGGPHVCIGRRYSLLLMKLLTARLVREFQMELSPEQAPLRLEAQM--VLKAQQGINV 478
            ..:.::.|:.||..|:|:..:...||.:.:.::..:::...|..   |:|.:|  .|..:.|:.|
plant   442 DGYKFVAFNAGPRTCLGKDLAYNQMKSVASAVLLRYRVFPVPGH---RVEQKMSLTLFMKNGLRV 503

  Fly   479  478
            plant   504  503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp311a1NP_572780.3 p450 30..480 CDD:278495 108/455 (24%)
CYP86A1NP_200694.1 CYP86A 70..501 CDD:410687 106/451 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 1 0.900 - - OOG6_100859
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.