DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp311a1 and CYP709B2

DIOPT Version :9

Sequence 1:NP_572780.3 Gene:Cyp311a1 / 32170 FlyBaseID:FBgn0030367 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_182218.2 Gene:CYP709B2 / 819309 AraportID:AT2G46950 Length:572 Species:Arabidopsis thaliana


Alignment Length:518 Identity:127/518 - (24%)
Similarity:224/518 - (43%) Gaps:73/518 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALWPLLLITLTIW----ILV-RKWTLLR--LGSSLPGPWAFPLLGNAQMVGKLRPEYIFLV--- 55
            :|:..:||:...|:    ||| |.|.|.|  ....:.||....|.||.:.:.|::.|...:|   
plant    65 LAIALVLLVVPKIYGACRILVWRPWMLSRRFKKQGISGPKYRILYGNLREIRKMKNEAKLMVLDP 129

  Fly    56 ------------FTELRDRFGATYRLRLG--PQLWVFLHSAEETRQALHDPTL--RKADTFMQLE 104
                        ..:.:.::|.|:....|  |:|.:..|  |..:|.|.:..:  .|:.|..::.
plant   130 NSNDIVPRVLPHLQQWKSQYGETFLYWQGTDPRLCISDH--ELAKQILSNKFVFFSKSKTKPEIL 192

  Fly   105 PLIGNGLLISHGAHWTRQRRLLTPAFQPQLLRSFAPAIGGHVERLV-----GRLGATRGAFLEVT 164
            .|.||||:..:|..|.|.||:|.|||....|:.....:.....|:.     .|.|.....|:.::
plant   193 KLSGNGLIFVNGLDWVRHRRILNPAFSMDKLKLMTQLMVDCTFRMFLEWKKQRNGVETEQFVLIS 257

  Fly   165 EPLFACLLDAIVDTSMGAQLDTQSVDHSPIIQAFHLSSKLLFKRMINPLLSSDWIF--------- 220
            ........|.|...:.|:       .::..|:.|  .|:|..::.....| :|..|         
plant   258 REFKRLTADIIATAAFGS-------SYAEGIEVF--KSQLELQKCCAAAL-TDLYFPGIQYLPTP 312

  Fly   221 QRTQLWRDLDEQLQVIHSQMESVIEKR-AKELLDMGEPAGRAHNLLDTLLLAKFEGQS---LSRR 281
            ...|:|: ||.:   ::|.::.:|:.| ..|..|.|      ::||..:|.|....:|   :|..
plant   313 SNLQIWK-LDMK---VNSSIKRIIDARLTSESKDYG------NDLLGIMLTAASSNESEKKMSID 367

  Fly   282 EIRDEINTFVFAGVDTTTAAMSFVLYALAKFPETQTRLRKEL-QDVALDETTDLDALNGLPYLEA 345
            ||.:|..||.|||.:||...:::....|:...:.|.:||:|: .:...|:..|.:..:.|..:..
plant   368 EIIEECKTFFFAGHETTANLLTWSTMLLSLHQDWQEKLREEVFNECGKDKIPDAETCSKLKLMNT 432

  Fly   346 LIKEVLRLYTIVPTTGRQTTQSTEIGGRTYCAGVTLWINMYGLAHDKEYY-PDPYAFKPERWLPE 409
            :..|.||||..|....|..::..::|......|.|:.:.:..:..||..: .|...|.|.|:...
plant   433 VFMESLRLYGPVLNLLRLASEDMKLGNLEIPKGTTIILPIAKMHRDKAVWGSDADKFNPMRFANG 497

  Fly   410 DGAVAPPAFSYIPFSGGPHVCIGRRYSLLLMKLLTARLVREFQMELSPE--QAP---LRLEAQ 467
            ....|....:.:.||.||..|||:.::::..|.:.|.:::.|::.||.:  .||   |.|:.|
plant   498 LSRAANHPNALLAFSMGPRACIGQNFAIMEAKTVLAMILQRFRLNLSADYKHAPADHLTLQPQ 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp311a1NP_572780.3 p450 30..480 CDD:278495 116/482 (24%)
CYP709B2NP_182218.2 p450 89..571 CDD:299894 119/494 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.920

Return to query results.
Submit another query.