DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp311a1 and CYP26B1

DIOPT Version :9

Sequence 1:NP_572780.3 Gene:Cyp311a1 / 32170 FlyBaseID:FBgn0030367 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_063938.1 Gene:CYP26B1 / 56603 HGNCID:20581 Length:512 Species:Homo sapiens


Alignment Length:525 Identity:134/525 - (25%)
Similarity:209/525 - (39%) Gaps:109/525 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLITLTIWILVRKWTLLRLGS-SLP---GPWAFPLLGNA-----QMVGKLRPEYIFLVFTELRD 61
            ||.::..:|.|  :|...|..| .||   |...|||:|..     |..|         ..:..|:
Human    25 LLAVSQQLWQL--RWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGSG---------FQSSRRE 78

  Fly    62 RFGATYRLRLGPQLWVFLHSAEETRQAL---HD--PTLRKADTFMQLEPLIGNGLLISHGAHWTR 121
            ::|..::..|..:..:.:..||..|:.|   |.  .|.....|.|.|.|   |.:..|.|.....
Human    79 KYGNVFKTHLLGRPLIRVTGAENVRKILMGEHHLVSTEWPRSTRMLLGP---NTVSNSIGDIHRN 140

  Fly   122 QRRLLTPAFQPQLLRSFAPAIGGHVERLVGRLGATRGAFLEVTEPLFACLLDAIVDTSMGAQLDT 186
            :|::.:..|..:.|.|:.|.|     :||                        |.||     |..
Human   141 KRKVFSKIFSHEALESYLPKI-----QLV------------------------IQDT-----LRA 171

  Fly   187 QSVDHSPIIQAFHLSSKLLFKRMINPLLSSDWIFQRTQLWRDLDEQLQVIHSQMESVIEK----- 246
            .| .|...|..:..:.||.|:..|..||.    |...:  .||....:|....:::|...     
Human   172 WS-SHPEAINVYQEAQKLTFRMAIRVLLG----FSIPE--EDLGHLFEVYQQFVDNVFSLPVDLP 229

  Fly   247 --------RAKELLDMG-EPAGR-------AHNLLDTLLL----AKFEGQSLSRREIRDEINTFV 291
                    :|:::|..| |.|.|       ..:.||.|.|    :|..|:.::.:|::|.....:
Human   230 FSGYRRGIQARQILQKGLEKAIREKLQCTQGKDYLDALDLLIESSKEHGKEMTMQELKDGTLELI 294

  Fly   292 FAGVDTTTAAMSFVLYALAKFPETQTRLRKELQDVAL--------DETTDLDALNGLPYLEALIK 348
            ||...||.:|.:.::..|.|.|....:||.||:...:        :.|..||.|:||.||:.:||
Human   295 FAAYATTASASTSLIMQLLKHPTVLEKLRDELRAHGILHSGGCPCEGTLRLDTLSGLRYLDCVIK 359

  Fly   349 EVLRLYTIVPTTGRQTTQSTEIGGRTYCAGVTLWINMYGL--AHD-KEYYPDPYAFKPERWLPED 410
            ||:||:|.:....|...|:.|:.|.....|   |..||.:  .|| ...:.|...|.|:|:....
Human   360 EVMRLFTPISGGYRTVLQTFELDGFQIPKG---WSVMYSIRDTHDTAPVFKDVNVFDPDRFSQAR 421

  Fly   411 GAVAPPAFSYIPFSGGPHVCIGRRYSLLLMKLLTARLVREFQMELSPEQAPLRLEAQMVLKAQQG 475
            .......|.|:||.||...|:|:..:.|.:|:|...|....:.||:....| |:....||....|
Human   422 SEDKDGRFHYLPFGGGVRTCLGKHLAKLFLKVLAVELASTSRFELATRTFP-RITLVPVLHPVDG 485

  Fly   476 INVSF 480
            ::|.|
Human   486 LSVKF 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp311a1NP_572780.3 p450 30..480 CDD:278495 125/498 (25%)
CYP26B1NP_063938.1 p450 23..490 CDD:325183 133/523 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4824
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.