DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp311a1 and Cyp4a3

DIOPT Version :9

Sequence 1:NP_572780.3 Gene:Cyp311a1 / 32170 FlyBaseID:FBgn0030367 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_038965516.1 Gene:Cyp4a3 / 298423 RGDID:631356 Length:511 Species:Rattus norvegicus


Alignment Length:508 Identity:151/508 - (29%)
Similarity:247/508 - (48%) Gaps:58/508 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLITLTIWILVRKWTLLRLGS--SLPGPWAFPLLGNAQMVGKLRPEYIFLVFTELRDRFGATYR 68
            |:|.....:.|.|:|.|..|..  |.|..|   |.|:     .|:......|.|.:....||..:
  Rat    29 LVLFKAVQFYLRRQWLLKALEKFPSTPSHW---LWGH-----DLKDREFQQVLTWVEKFPGACLQ 85

  Fly    69 LRLGPQLWVFLHSAEETRQALHDP-----TLRKAD-----TFMQLEPLI----GNGLLISHGAHW 119
                   |:   |..:||..|:||     .|.::|     .:..|.|.|    |.|||:.:|..|
  Rat    86 -------WL---SGSKTRVLLYDPDYVKVVLGRSDPKASGIYQFLAPWIVSGTGYGLLLLNGKKW 140

  Fly   120 TRQRRLLTPAFQPQLLRSFAPAIGGHVERLVGRLGA--TRGAFLEVTEPLFACLLDAIVDTSM-- 180
            .:..|:|||||...:|:.:...:...|..::.:...  .:...||:...:....||.::..:.  
  Rat   141 FQHWRMLTPAFHYGILKPYVKIMADSVSIMLDKWEKLDDQDHPLEIFHYVSLMTLDTVMKCAFSH 205

  Fly   181 --GAQLDTQSVDHSPIIQAFHLSSKLLFKRMINPLLSSDWIFQRTQLWRDLDEQLQVIHSQMESV 243
              ..|||..|..::..::..   :.|.|.|:.:....:..|:..:...|......|:.|...:.|
  Rat   206 QGSVQLDVNSRSYTKAVEDL---NNLTFFRVRSAFYGNSIIYNMSSDGRLSRRACQIAHEHTDGV 267

  Fly   244 IEKRAKELL---DMGEPAGRAH-NLLDTLLLAKFE-GQSLSRREIRDEINTFVFAGVDTTTAAMS 303
            |:.|..:|.   ::.:...:.| :.||.||.||.| |:|||..::|.|::||:|.|.|||.:.:|
  Rat   268 IKMRKAQLQNEEELQKARKKRHLDFLDILLFAKMEDGKSLSDEDLRAEVDTFMFEGHDTTASGIS 332

  Fly   304 FVLYALAKFPETQTRLRKELQDVALDETT-DLDALNGLPYLEALIKEVLRLYTIVPTTGRQ-TTQ 366
            :|.||||..||.|.|.|:|:|.:..|.|: ..|.|:.:.|....|||.||||..||:..|: ::.
  Rat   333 WVFYALATHPEHQERCREEVQSILGDGTSVTWDHLDQISYTTMCIKEALRLYPPVPSVSRELSSP 397

  Fly   367 STEIGGRTYCAGVTLWINMYGLAHDKEYYPDPYAFKPERWLPEDGAVAPPAFS--YIPFSGGPHV 429
            .|...||:...|:|..|.:|||.|:..|:|:|..|.|.|:.|:.     |..|  |:|||||...
  Rat   398 VTFPDGRSIPKGITTTILIYGLHHNPSYWPNPKVFDPSRFSPDS-----PRHSHAYLPFSGGARN 457

  Fly   430 CIGRRYSLLLMKLLTARLVREFQMELSPEQAPLRLEAQMVLKAQQGINVSFLK 482
            |||:::::..:|:..|..:..|::...|.:.|:.: |::|||::.||::...|
  Rat   458 CIGKQFAMNELKVAVALTLLRFELLPDPTRIPVPM-ARLVLKSKNGIHLRLKK 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp311a1NP_572780.3 p450 30..480 CDD:278495 142/478 (30%)
Cyp4a3XP_038965516.1 CYP4B-like 69..506 CDD:410771 137/455 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.