DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp311a1 and CYP4A22

DIOPT Version :9

Sequence 1:NP_572780.3 Gene:Cyp311a1 / 32170 FlyBaseID:FBgn0030367 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:502 Identity:154/502 - (30%)
Similarity:248/502 - (49%) Gaps:55/502 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLITLTIWILVRKWTLLRLGSSLPGPWAFPLLGNAQMVGKLRPEYIFLVFTELRDRFGATYRLR 70
            ||||......|.|:| ||:.....|.|.:..|.|:.|            .|...::......|::
Human    29 LLLIKAAQLYLHRQW-LLKALQQFPCPPSHWLFGHIQ------------EFQHDQELQRIQERVK 80

  Fly    71 LGPQ---LWVFLHSAEETRQALHDPTLRKA----------DTFMQLEPLIGNGLLISHGAHWTRQ 122
            ..|.   .|::   ..:.|..|:||...|.          .::..|.|.||.|||:.:|..|.:.
Human    81 TFPSACPYWIW---GGKVRVQLYDPDYMKVILGRSDPKSHGSYKFLAPRIGYGLLLLNGQTWFQH 142

  Fly   123 RRLLTPAFQPQLLRSFAPAIGGHV-------ERLVGRLGATRGAFLEVTEPLFACLLDAIVDTSM 180
            ||:|||||...:|:.:...:...|       |.|:|     :.:.|||.:.:....||.|:.::.
Human   143 RRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLG-----QDSPLEVFQHVSLMTLDTIMKSAF 202

  Fly   181 GAQLDTQSVDHS--PIIQAFHLSSKLLFKRMINPLLSSDWIFQRTQLWRDLDEQLQVIHSQMESV 243
            ..|...| ||.:  ..|||....:.|:|..|.|....:|.|:..|...|......|:.|...:.|
Human   203 SHQGSIQ-VDRNSQSYIQAISDLNSLVFCCMRNAFHENDTIYSLTSAGRWTHRACQLAHQHTDQV 266

  Fly   244 IEKRAKELLDMGE----PAGRAHNLLDTLLLAKFE-GQSLSRREIRDEINTFVFAGVDTTTAAMS 303
            |:.|..:|...||    ...|..:.||.|||||.| |..||.:::|.|::||:|.|.|||.:.:|
Human   267 IQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGIS 331

  Fly   304 FVLYALAKFPETQTRLRKELQDVALD-ETTDLDALNGLPYLEALIKEVLRLYTIVPTTGRQ-TTQ 366
            ::|||||..|:.|.|.|:|:..:..| .:...:.|:.:||....|||.||||..||..||: :|.
Human   332 WILYALATHPKHQERCREEIHGLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTP 396

  Fly   367 STEIGGRTYCAGVTLWINMYGLAHDKEYYPDPYAFKPERWLPEDGAVAPPAFSYIPFSGGPHVCI 431
            .|...||:...|:.:.:::|||.|:.:.:|:...|.|.|:.|   ..|..:.:::|||||...||
Human   397 VTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNLEVFDPSRFAP---GSAQHSHAFLPFSGGSRNCI 458

  Fly   432 GRRYSLLLMKLLTARLVREFQMELSPEQAPLRLEAQMVLKAQQGINV 478
            |:::::..:|:..|..:..|::...|.:.|:.: |::|||::.||::
Human   459 GKQFAMNQLKVARALTLLRFELLPDPTRIPIPM-ARLVLKSKNGIHL 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp311a1NP_572780.3 p450 30..480 CDD:278495 145/478 (30%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 145/478 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.