DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp311a1 and cyp-25A6

DIOPT Version :9

Sequence 1:NP_572780.3 Gene:Cyp311a1 / 32170 FlyBaseID:FBgn0030367 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001360017.1 Gene:cyp-25A6 / 187059 WormBaseID:WBGene00019438 Length:235 Species:Caenorhabditis elegans


Alignment Length:192 Identity:37/192 - (19%)
Similarity:76/192 - (39%) Gaps:36/192 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LITLTIWILVRKWTLLRLGS--SLPGPWAFPLLGNAQMV----GKLRPEYIFLVFTELRDRFGAT 66
            |::..|::::.:....||..  .|.||....|:||.:.:    .||..:..:..:.:|..:||.|
 Worm    13 LVSFIIYVILARKERFRLRGKIGLSGPEPHWLMGNLKQIIERKAKLGYDDSYDWYNKLHKQFGET 77

  Fly    67 YRLRLGPQLWVFLHSAEETRQA----------------LHDPTLRKADTFMQLEPLIGNGLLISH 115
            :.:..|.||.:.:.:.|:.::.                :.|..|:        |.|:.|    ::
 Worm    78 FGIYFGTQLNINITNEEDIKEVFIKNFSNFSDRTPPPIIEDNKLK--------ESLLQN----TY 130

  Fly   116 GAHWTRQRRLLTPAFQPQLLRSFAPAIGGHVERLVGRL--GATRGAFLEVTEPLFACLLDAI 175
            .:.|...|..:.|.|....:::....|...|:..:..|  .|:.|...::.:......||.|
 Worm   131 ESGWKHTRSAIAPIFSTGKMKAMHETIHSKVDLFLEILKEKASSGQKWDIYDDFQGLTLDVI 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp311a1NP_572780.3 p450 30..480 CDD:278495 32/168 (19%)
cyp-25A6NP_001360017.1 p450 37..>215 CDD:386267 32/168 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D786853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.