DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp311a1 and cyp4f3

DIOPT Version :9

Sequence 1:NP_572780.3 Gene:Cyp311a1 / 32170 FlyBaseID:FBgn0030367 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001083010.1 Gene:cyp4f3 / 100037390 ZFINID:ZDB-GENE-070410-108 Length:511 Species:Danio rerio


Alignment Length:409 Identity:119/409 - (29%)
Similarity:201/409 - (49%) Gaps:27/409 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 TLRKADTFMQLEPLIGNGLLISHGAHWTRQRRLLTPAFQPQLLRSFAPAIGGHVERLVG---RLG 154
            ||:....:..::|.:||.||:..|..|:|.||||||||...:|:.:..........:..   ||.
Zfish   103 TLKDRIFYGFMKPWLGNCLLLQSGQEWSRHRRLLTPAFHFDILKKYVHIFNQSTNIMHDEWRRLL 167

  Fly   155 ATRGAFLEVTEPLFACLLDAIVDTSMGAQLDTQSVDHSPIIQAFHLSSKLLFKRMINPLLSSDWI 219
            |.....:::.|.:.:..||:::..:......:|......|.....| |:||.:|........||:
Zfish   168 AKGEHSVDMFEQISSLTLDSLLKCTFSCDTHSQEKPRQYISAILDL-SRLLVQRQHYLPYHWDWL 231

  Fly   220 FQRTQLWRDLDEQLQVIHSQMESVIEKRAKELLDMGEPAGRAHN-----------LLDTLLLAKF 273
            :.|:...|...:...|:|.....::::|..:|....:|.....|           |:|.|||||.
Zfish   232 YWRSAQGRRFQQACAVVHQFTADIVQERRTQLDQQSDPESHPENTGRYRKRKNTDLIDLLLLAKD 296

  Fly   274 E-GQSLSRREIRDEINTFVFAGVDTTTAAMSFVLYALAKFPETQTRLRKELQDVALDETTDL--- 334
            : |:.|:..||:...:.|:|||.|||.:|:|::.|.||...:.|.|.|.|::|:..|..|..   
Zfish   297 DKGEGLTNEEIKAHADMFMFAGHDTTASALSWIFYNLAMNQDYQERCRAEVRDLLADRDTHTIGW 361

  Fly   335 DALNGLPYLEALIKEVLRLYTIVPTTGRQTTQSTEIGGRTYCA---GVTLWINMYGLAHDKEYYP 396
            :.|:.|.:....|||.|||::.|....|..:|:.:..|.  |.   |....|::||:..:.:.:|
Zfish   362 EDLSQLTFTTMCIKESLRLHSPVLALTRYYSQNMKTPGD--CVIPHGCLCLISIYGVHRNPQVWP 424

  Fly   397 DPYAFKPERWLPEDGAVAPPAFSYIPFSGGPHVCIGRRYSLLLMKLLTARLVREFQMELSPEQAP 461
            ||..|.|.|:.|.:.....| .::||||.||..|||:.:::..||::.|..:..|  ::.|...|
Zfish   425 DPLVFDPTRFDPHNSDSRSP-HAFIPFSAGPRNCIGQNFAMAEMKVVVALTLARF--KILPGPKP 486

  Fly   462 LRLEAQMVLKAQQGINVSF 480
            :|...|:||:|:.|:.:.|
Zfish   487 VRRLYQLVLRAEGGMILHF 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp311a1NP_572780.3 p450 30..480 CDD:278495 118/407 (29%)
cyp4f3NP_001083010.1 p450 38..503 CDD:278495 118/405 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100859
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.