Sequence 1: | NP_004493.3 | Gene: | HOXB7 / 3217 | HGNCID: | 5118 | Length: | 217 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_536752.1 | Gene: | Ubx / 42034 | FlyBaseID: | FBgn0003944 | Length: | 389 | Species: | Drosophila melanogaster |
Alignment Length: | 215 | Identity: | 86/215 - (40%) |
---|---|---|---|
Similarity: | 106/215 - (49%) | Gaps: | 68/215 - (31%) |
- Green bases have known domain annotations that are detailed below.
Human 44 GAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAA 108
Human 109 GAKEQRDSDLAAESNFRIYPWMRSSG----------------------TD--------------- 136
Human 137 --------RKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWK 193
Human 194 KENKTAGPGTTGQDRAEAEE 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HOXB7 | NP_004493.3 | Antp-type hexapeptide | 126..131 | 3/4 (75%) | |
Homeobox | 141..193 | CDD:278475 | 47/51 (92%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 194..217 | 4/20 (20%) | |||
Ubx | NP_536752.1 | Homeobox | 299..352 | CDD:395001 | 47/52 (90%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45659 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.910 |