DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB7 and Ubx

DIOPT Version :9

Sequence 1:NP_004493.3 Gene:HOXB7 / 3217 HGNCID:5118 Length:217 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:215 Identity:86/215 - (40%)
Similarity:106/215 - (49%) Gaps:68/215 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    44 GAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAA 108
            |..:|.:.:.|      ||.|.||...:||..||.|   :::|.:|     .:||.    :|:.|
  Fly   180 GGSAGGNVSVS------GGNGNAGGVQSGVGVAGAG---TAWNANC-----TISGA----AAQTA 226

Human   109 GAKEQRDSDLAAESNFRIYPWMRSSG----------------------TD--------------- 136
            .|     |.|...||...||||..:|                      ||               
  Fly   227 AA-----SSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLP 286

Human   137 --------RKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWK 193
                    |:|||||||||||||||||||.|.|||||||||:||.||||||||||||||||||.|
  Fly   287 DWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLK 351

Human   194 KENKTAGPGTTGQDRAEAEE 213
            ||.:........:.:|:|::
  Fly   352 KEIQAIKELNEQEKQAQAQK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB7NP_004493.3 Antp-type hexapeptide 126..131 3/4 (75%)
Homeobox 141..193 CDD:278475 47/51 (92%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..217 4/20 (20%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.