DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB7 and ftz

DIOPT Version :9

Sequence 1:NP_004493.3 Gene:HOXB7 / 3217 HGNCID:5118 Length:217 Species:Homo sapiens
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:116 Identity:59/116 - (50%)
Similarity:75/116 - (64%) Gaps:12/116 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   101 PGDSAKAAGAKEQRDSDLAAESNFRIYPW------MRSSGTDRKRGRQTYTRYQTLELEKEFHYN 159
            ||:.:.:|.::|.....:.|.:....:.|      :.|...|.||.|||||||||||||||||:|
  Fly   212 PGEKSSSAVSQEINHRIVTAPNGAGDFNWSHIEETLASDCKDSKRTRQTYTRYQTLELEKEFHFN 276

Human   160 RYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKEN------KTAGPGTT 204
            ||:||||||:||:.|.|:||||||||||||||.||:.      :..|.|.|
  Fly   277 RYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKDRTLDSSPEHCGAGYT 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB7NP_004493.3 Antp-type hexapeptide 126..131 1/10 (10%)
Homeobox 141..193 CDD:278475 44/51 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..217 4/17 (24%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 6/35 (17%)
Homeobox 257..310 CDD:278475 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.