DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp7 and usp9

DIOPT Version :9

Sequence 1:NP_572779.2 Gene:Usp7 / 32169 FlyBaseID:FBgn0030366 Length:1129 Species:Drosophila melanogaster
Sequence 2:XP_005167793.1 Gene:usp9 / 568683 ZFINID:ZDB-GENE-061019-1 Length:2594 Species:Danio rerio


Alignment Length:480 Identity:126/480 - (26%)
Similarity:200/480 - (41%) Gaps:126/480 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 GYVGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIP------------TEADDSSKSVGLSLQRVF 291
            |:|||||.||||||||::|.||....:|..:..|.            .|..|:..:|....:...
Zfish  1554 GFVGLKNAGATCYMNSVIQQLYMIPPIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDEVFG 1618

  Fly   292 HELQFGDRP------------VGT-KKLTKSFG---------------------W-ETLDSFMQH 321
            ::.||.|:|            :|. ::|...||                     | |.::...||
Zfish  1619 YQHQFDDKPSLSKSEDRKEYNIGVLRQLQVIFGHLASSRLQYYVPRGFWKQFRLWGEPVNLREQH 1683

  Fly   322 DVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIKCKNVDYNSTRYETFYDIQLNIKDKKN 386
            |..||...|:|.|:..:|.......:..:..|..:....|:...:.....|:|..:.::|::.:|
Zfish  1684 DALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEESFTTLNVDIRNHQN 1748

  Fly   387 IYESFQDYVAPETLEGDNKYDAGVHGLQEASKGV------IFTSFPPVLHLHLMRFQYDPVTDSS 445
            :.:|.:.||..:.|||.|.|..     ::.:|.|      :....||||.:.|.||.||...:.:
Zfish  1749 LLDSMEQYVKGDLLEGANAYHC-----EKCNKKVDTVKRLLIKKLPPVLAIQLKRFDYDWERECA 1808

  Fly   446 IKYNDRFEFYEHINLDRY----LAESENT-----------------------LADYVLHAVLVHS 483
            ||:||.|||...::::.|    :|:.|.:                       .:.|.|..|||||
Zfish  1809 IKFNDYFEFPRELDMEPYTVAGVAKLEGSDVHPENQQQVIQQNEPSEPEPPCSSRYRLVGVLVHS 1873

  Fly   484 GDNHGGHYVVFINPK----ADG---RWFKFDDDVVSSCR---KQEAIEQNYGG---------MDD 529
            |...||||..:|..:    .:|   ||:||||..|:.|:   .:|...|.:||         |..
Zfish  1874 GQASGGHYYSYIIQRNGSGGEGERNRWYKFDDGDVTECKMDDDEEMKNQCFGGEYMGEVFDHMMK 1938

  Fly   530 EISF--HAKCSNAYMLVYIRQSELDR---VLGDITESEISSDLVERLDLEKRIEMARRKERGEAN 589
            .:|:  ..:..|||:|.|.|...||:   ::..|||..:||. ..::.:...||.:.||      
Zfish  1939 RMSYRRQKRWWNAYILFYERMDTLDKDSELVKYITELTVSSK-PHQVKMPSAIERSVRK------ 1996

  Fly   590 TYVSVHVILEENFEEQHKRRLFDLE 614
                      :|.:..|.|..:.||
Zfish  1997 ----------QNVQFMHNRMQYSLE 2011

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp7NP_572779.2 MATH_HAUSP 100..229 CDD:239741
COG5077 101..1119 CDD:227409 126/480 (26%)
peptidase_C19C 239..549 CDD:239124 110/410 (27%)
USP7_ICP0_bdg 647..886 CDD:289221
USP7_C2 897..1113 CDD:291217
usp9XP_005167793.1 peptidase_C19C 1554..1961 CDD:239124 110/411 (27%)
UCH 1556..1956 CDD:278850 107/404 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.