DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp7 and Usp1

DIOPT Version :9

Sequence 1:NP_572779.2 Gene:Usp7 / 32169 FlyBaseID:FBgn0030366 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_001263061.1 Gene:Usp1 / 43462 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster


Alignment Length:290 Identity:63/290 - (21%)
Similarity:95/290 - (32%) Gaps:82/290 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 GYVGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLSLQRVFH-ELQFGDRPVG 302
            |..|.....||.      .:|::.|::.||      .|..:|.|...|...|.. .......|..
  Fly   574 GITGAGTAHATA------NSLFYLNTVDLS------GASSTSGSASTSASGVVSTSAALPTPPQA 626

  Fly   303 TKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGL--------FEGKMSSYI 359
            ||             :...|......||.||:.       ||..|..|        |||.:....
  Fly   627 TK-------------YSSDDEMNSATVLKDKMR-------LEERIRELNLNFFSSDFEGIVVLTT 671

  Fly   360 KCKNVDYNSTRYETFYDIQL----------NIKDKKNIYESFQDYVAPETLEGDNKYDAG-VHGL 413
            ||.:.:..:.:.:...||.:          :::||.:.|.. ...:..|...|:|||... ..|.
  Fly   672 KCLSCETITRQKQGMLDISVPVPISGYDNADLQDKPSTYIQ-NSCITKEYFRGENKYSCNQCTGY 735

  Fly   414 QEASKGVIFTSFPPVLHLHLMRFQ--------YDPVTDSSIKYNDRFEFYEHINLDRYLAE---- 466
            .||.:.:.:...|.:|.:.|.||.        |.|.|               ..|..:.|.    
  Fly   736 TEAIRSISYEVLPRLLVIQLNRFSGGMEKVSTYVPTT---------------FTLPCFCATCCEL 785

  Fly   467 -SENTLADYVLHAVLVHSGDN-HGGHYVVF 494
             ..|.|..|.|::|:.|.|.. ..|||:.:
  Fly   786 GEGNKLHVYKLYSVITHVGATLTVGHYIAY 815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp7NP_572779.2 MATH_HAUSP 100..229 CDD:239741
COG5077 101..1119 CDD:227409 63/290 (22%)
peptidase_C19C 239..549 CDD:239124 63/290 (22%)
USP7_ICP0_bdg 647..886 CDD:289221
USP7_C2 897..1113 CDD:291217
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 63/290 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24006
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.