DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp7 and bath-36

DIOPT Version :9

Sequence 1:NP_572779.2 Gene:Usp7 / 32169 FlyBaseID:FBgn0030366 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_506750.1 Gene:bath-36 / 190718 WormBaseID:WBGene00013569 Length:320 Species:Caenorhabditis elegans


Alignment Length:272 Identity:61/272 - (22%)
Similarity:105/272 - (38%) Gaps:59/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 FTVENVVQLKSQRLSPPVYVRMLPWRIMVIP-------NDRALGFFLQCNGENDSPTWSCNA--- 160
            |.::|...|.......||.:..:.|.:....       |.:.||..|:||.|..|..|||:|   
 Worm    12 FEIQNFSGLAKATEHKPVQIGHVEWILGAFTSTSDATNNAKHLGIHLKCNEELRSNLWSCDASIR 76

  Fly   161 IAELRLKCHKPDAQPFTRARIKHLFYSKENDYG----YSNFITWQELKDSEKSYVHNNSITLEVH 221
            .:.|||..::.| ..|:..     |..|.:|..    .:||..|:|....:..:|.:....|||.
 Worm    77 FSLLRLNSNEDD-DAFSME-----FQQKFDDLNKIVVVNNFKNWEEAICYDNRFVLDKHAVLEVQ 135

  Fly   222 VVADAPHGV------LWDS-KKHTGYVGLKNQGATCYM--------NSLLQTLYFTNSLRLSVYR 271
            :..:...|:      .:|. |:|...|.|..:|...::        :...|.::::|....:...
 Worm   136 ITVNKIAGIHERIIETFDQPKEHLTDVVLVLEGKHVHVGKQVLATSSQFFQKMFYSNFAEKTQAE 200

  Fly   272 IPTEADDSSKSVGLSL-------------QRVFHELQFGDRPVGTKKLTKSFGWETLDSFMQHDV 323
            |  :.||.:.|..:.|             ..|.|.|:..||....:.|.|:      ::|:..|.
 Worm   201 I--KIDDVTHSEFIDLLNVIYPTHMLINSSNVSHLLKLSDRFAVPRVLEKA------ETFLILDQ 257

  Fly   324 QEFLRVLLDKLE 335
            :..   |:|||:
 Worm   258 KTH---LIDKLK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp7NP_572779.2 MATH_HAUSP 100..229 CDD:239741 34/136 (25%)
COG5077 101..1119 CDD:227409 61/272 (22%)
peptidase_C19C 239..549 CDD:239124 23/118 (19%)
USP7_ICP0_bdg 647..886 CDD:289221
USP7_C2 897..1113 CDD:291217
bath-36NP_506750.1 MATH 8..137 CDD:295307 34/130 (26%)
BTB 156..254 CDD:279045 20/105 (19%)
BTB 161..254 CDD:197585 18/100 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.