DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp7 and math-18

DIOPT Version :10

Sequence 1:NP_572779.2 Gene:Usp7 / 32169 FlyBaseID:FBgn0030366 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_494201.2 Gene:math-18 / 183351 WormBaseID:WBGene00016544 Length:273 Species:Caenorhabditis elegans


Alignment Length:106 Identity:29/106 - (27%)
Similarity:40/106 - (37%) Gaps:29/106 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 LPWRIMVIPNDRALGFFLQCNG---ENDSPTWSCNAIAELRLKCHKPDA--------QPFTRARI 181
            :||||.:......||.:|.|..   |.......|....:|.....|.||        ||:.|.  
 Worm   173 IPWRITISKCHERLGIYLYCKKAVCEGKKYEVKCEFEVQLISSSGKCDAGRRSVVFDQPYGRG-- 235

  Fly   182 KHLFYSKENDYGYSNFITWQELKDSEKSYVHNNSITLEVHV 222
                         ...|:|:::|   |.||.|:||.:||.|
 Worm   236 -------------MTLISWEKMK---KYYVDNDSINVEVIV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp7NP_572779.2 Peptidase_C19 101..1119 CDD:470612 29/106 (27%)
math-18NP_494201.2 MATH 14..128 CDD:425944
MATH 151..262 CDD:425944 29/106 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.