DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and Strn3

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_036013597.1 Gene:Strn3 / 94186 MGIID:2151064 Length:853 Species:Mus musculus


Alignment Length:487 Identity:107/487 - (21%)
Similarity:191/487 - (39%) Gaps:72/487 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LKRTHDLFVSNQGNLPEIDERLEKLRRSIKAKDGYGLVLDKVAKIGEARKASGAQTPGDKTLAIT 83
            |..|.:::..:||.:.::.|:.:|.|   |.|.|       |.::............||..|...
Mouse   390 LSPTAEVWDVDQGLISKLKEQYKKER---KGKKG-------VKRVNRTNLCDMITDLGDDELPHI 444

  Fly    84 DGSATDAASGAGSLVKYNAGARPAEKTAPL----------VTGTHTSLVRASLANSNADMS-ANG 137
            .....:.:..|.:.:..:.||| ||:..|:          :.|:...|:........||:: .|.
Mouse   445 PSGIINQSRSASTRMADHEGAR-AEEAEPITFPSGGGKSFIMGSDDVLLSVLGLGDLADLTVTND 508

  Fly   138 AIASHLQLIPKKAPSIP--KPKWHAPWKLSRVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWD 200
            |..|:         .:|  |..:...|.....:..|...||.:|..|......|.:.|..:|:|:
Mouse   509 ADYSY---------DLPANKDAFRKTWNPKYTLRSHFDGVRALAFHPVEPVLVTASEDHTLKLWN 564

  Fly   201 L---ASGKLKLSL--------TGHVSTVRGVAVSTKHPYLFSCGEDRQVKCWDL----------- 243
            |   ...|...||        ..|:..|..:|:|:.....||.|.|..::.|::           
Mouse   565 LQKTVPAKKSASLDVEPIYTFRAHIGPVLSLAISSNGEQCFSGGIDATIQWWNMPSPNVDPYDTY 629

  Fly   244 EYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKAN-VHTLTG--HTNTVASVV 305
            |.|.:......|..||:.||.....:.|.:...|.|.|:|:.:.|.. |.|..|  ......||.
Mouse   630 ESNVLAGTLVAHTDAVWGLAYSGIKNQLLSCSADGTIRLWNPQEKLPCVCTYNGDKEHGIPTSVD 694

  Fly   306 AQATNP-QIITGSHDSTVRLWDLAAGKSVCTLTNHKKS-------VRSIVLHPSLYMFASASPD- 361
            ....:| .::|..:..:..::||...:|:..|::...|       :..:|.||:|.:..:|..| 
Mouse   695 FIGCDPAHMVTSFNTGSAVIYDLETSQSLVMLSSQVDSGLQSSNHINRVVSHPTLPVTITAHEDR 759

  Fly   362 NIKQWRCPEGKFVQNISGHTSIVNCMAANSEGV-LVSGGDNGTMFFWDWRTGYNFQRFQAPVQPG 425
            :||.:....||.:.::..|...|..:|.:..|: |:||..:.::..|:..:....|...|  ...
Mouse   760 HIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITA--HRK 822

  Fly   426 SMDSEAGIFAMCFDQSGSRLITAEADKTIKVY 457
            .:|.  .|:.:.|..|.:.:.:|.||...||:
Mouse   823 KLDE--SIYDVAFHPSKAYIASAGADALAKVF 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 77/332 (23%)
WD40 164..458 CDD:238121 76/329 (23%)
WD40 repeat 177..212 CDD:293791 10/45 (22%)
WD40 repeat 218..254 CDD:293791 9/46 (20%)
WD40 repeat 259..295 CDD:293791 11/36 (31%)
WD40 repeat 302..337 CDD:293791 7/35 (20%)
WD40 repeat 343..378 CDD:293791 10/35 (29%)
WD40 repeat 386..426 CDD:293791 8/40 (20%)
WD40 repeat 433..457 CDD:293791 7/23 (30%)
Strn3XP_036013597.1 Striatin 65..190 CDD:400507
WD40 531..852 CDD:238121 75/324 (23%)
WD40 repeat 541..587 CDD:293791 10/45 (22%)
WD40 repeat 593..631 CDD:293791 7/37 (19%)
WD40 repeat 645..683 CDD:293791 11/37 (30%)
WD40 repeat 691..727 CDD:293791 7/35 (20%)
WD40 repeat 740..776 CDD:293791 10/35 (29%)
WD40 repeat 782..821 CDD:293791 9/40 (23%)
WD40 repeat 828..852 CDD:293791 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.