DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and TBL1Y

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_016885575.1 Gene:TBL1Y / 90665 HGNCID:18502 Length:577 Species:Homo sapiens


Alignment Length:552 Identity:111/552 - (20%)
Similarity:185/552 - (33%) Gaps:182/552 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VQKHSVHTLIFRSLKR---THDLFV---------SN-QGNLPEIDERLEKLRRSIK--------A 49
            :....|:.|::|.|:.   :|..|.         || .|.|......:..|::.::        .
Human     3 ITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPSALISILQKGLQYVEAEISIN 67

  Fly    50 KDG----------YGLVLDKVAKIGEARKASGAQTPGDKTLAITDGSATDAASGAGSLVKYNAGA 104
            |||          ..|::..:..:.:.|:    |..|:|   :|...|:.||:.|.::      |
Human    68 KDGTVFDSRPIESLSLIVAVIPDVVQMRQ----QAFGEK---LTQQQASAAATEASAM------A 119

  Fly   105 RPAEKTAPLVTGTHTSLVRASLANSNADMSANGA--IASH---------LQLIPKKAPSIPKPKW 158
            :.|..|...::..:....|.:..|.    ..|||  |.:|         :::.|.||        
Human   120 KAATMTPAAISQQNPPKNREATVNG----EENGAHEINNHSKPMEIDGDVEIPPNKA-------- 172

  Fly   159 HAPWKLSRVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWDL---------------------- 201
                   .|:.||...|...|..|.::..|:|:||...:||:|                      
Human   173 -------TVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGH 230

  Fly   202 ---------------------------------ASGKLKLSLTGHVSTVRGVAVSTKHPYLFSCG 233
                                             .:|.|..:|..|...:..:..:.|..|:.|.|
Human   231 DVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTENGNLASTLGQHKGPIFALKWNKKGNYVLSAG 295

  Fly   234 EDRQVKCWD-----------------------------------------LEYNKVIRHYHGHLS 257
            .|:....||                                         |..:..::.:.||.:
Human   296 VDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMTFASCSTDMCIHVCRLGCDHPVKTFQGHTN 360

  Fly   258 AVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGHTNTVASVVAQATNP---------QI 313
            .|.::...|:..:||:...|.|.:||.|:..|.||.|..|:..:.::....|.|         .:
Human   361 EVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATSNPNSSIML 425

  Fly   314 ITGSHDSTVRLWDLAAGKSVCTLTNHKKSVRSIVLHPSLYMFASASPDN-IKQWRCPEGKFVQNI 377
            .:.|.||||||||:..|....||..|::.|.|:...|.....||.|.|. :..|....|..|.:.
Human   426 ASASFDSTVRLWDVEQGVCTHTLMKHQEPVYSVAFSPDGKYLASGSFDKYVHIWNTQSGSLVHSY 490

  Fly   378 SGHTSIVN-CMAANSEGVLVSGGD-NGTMFFW 407
            .|...|.. |..|..:.|..|..| :.::..|
Human   491 QGTGGIFEVCWNARGDKVGASASDGSDSLAVW 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 74/355 (21%)
WD40 164..458 CDD:238121 74/352 (21%)
WD40 repeat 177..212 CDD:293791 12/89 (13%)
WD40 repeat 218..254 CDD:293791 8/76 (11%)
WD40 repeat 259..295 CDD:293791 12/35 (34%)
WD40 repeat 302..337 CDD:293791 13/43 (30%)
WD40 repeat 343..378 CDD:293791 10/35 (29%)
WD40 repeat 386..426 CDD:293791 6/23 (26%)
WD40 repeat 433..457 CDD:293791
TBL1YXP_016885575.1 LisH 6..32 CDD:312123 6/25 (24%)
WD40 174..480 CDD:238121 63/305 (21%)
WD40 repeat 182..229 CDD:293791 10/46 (22%)
WD40 repeat 239..274 CDD:293791 3/34 (9%)
WD40 repeat 279..356 CDD:293791 8/76 (11%)
WD40 repeat 363..398 CDD:293791 11/34 (32%)
WD40 repeat 404..449 CDD:293791 13/44 (30%)
WD40 repeat 455..493 CDD:293791 10/37 (27%)
WD40 repeat 496..522 CDD:293791 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.