DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and LST8

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_014392.3 Gene:LST8 / 855726 SGDID:S000004951 Length:303 Species:Saccharomyces cerevisiae


Alignment Length:230 Identity:54/230 - (23%)
Similarity:82/230 - (35%) Gaps:51/230 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 GHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKHPYLFSCGE 234
            ||.|.|..::.:..|.|..|.:.|..||:||:.|..:..:.. |.:.|..|.:......|.||..
Yeast    73 GHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDR 136

  Fly   235 DRQVKCWDLEYN-------------------------------------------------KVIR 250
            |..::.|||..|                                                 |.:.
Yeast   137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVT 201

  Fly   251 HYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVH-TLTGHTNTVASVVAQATNPQII 314
            .:..|.:.:..:.|...:..|||...|.|||:|.:.....:. ||.||...|......|.:..::
Yeast   202 KFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLV 266

  Fly   315 TGSHDSTVRLWDLAAGKSVCTLTNHKKSVRSIVLH 349
            |.|.|..||||||:..:.|.....|.|....:.|:
Yeast   267 TASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 54/230 (23%)
WD40 164..458 CDD:238121 54/230 (23%)
WD40 repeat 177..212 CDD:293791 9/34 (26%)
WD40 repeat 218..254 CDD:293791 10/84 (12%)
WD40 repeat 259..295 CDD:293791 10/36 (28%)
WD40 repeat 302..337 CDD:293791 11/34 (32%)
WD40 repeat 343..378 CDD:293791 1/7 (14%)
WD40 repeat 386..426 CDD:293791
WD40 repeat 433..457 CDD:293791
LST8NP_014392.3 WD40 4..278 CDD:238121 47/205 (23%)
WD40 repeat 36..73 CDD:293791 54/230 (23%)
WD40 repeat 78..114 CDD:293791 10/35 (29%)
WD40 repeat 120..155 CDD:293791 9/34 (26%)
WD40 repeat 162..204 CDD:293791 1/41 (2%)
WD40 repeat 210..247 CDD:293791 10/36 (28%)
WD40 repeat 253..277 CDD:293791 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.