Sequence 1: | NP_572778.1 | Gene: | Tango4 / 32168 | FlyBaseID: | FBgn0030365 | Length: | 482 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_014392.3 | Gene: | LST8 / 855726 | SGDID: | S000004951 | Length: | 303 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 230 | Identity: | 54/230 - (23%) |
---|---|---|---|
Similarity: | 82/230 - (35%) | Gaps: | 51/230 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 170 GHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKHPYLFSCGE 234
Fly 235 DRQVKCWDLEYN-------------------------------------------------KVIR 250
Fly 251 HYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVH-TLTGHTNTVASVVAQATNPQII 314
Fly 315 TGSHDSTVRLWDLAAGKSVCTLTNHKKSVRSIVLH 349 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tango4 | NP_572778.1 | WD40 | <161..458 | CDD:225201 | 54/230 (23%) |
WD40 | 164..458 | CDD:238121 | 54/230 (23%) | ||
WD40 repeat | 177..212 | CDD:293791 | 9/34 (26%) | ||
WD40 repeat | 218..254 | CDD:293791 | 10/84 (12%) | ||
WD40 repeat | 259..295 | CDD:293791 | 10/36 (28%) | ||
WD40 repeat | 302..337 | CDD:293791 | 11/34 (32%) | ||
WD40 repeat | 343..378 | CDD:293791 | 1/7 (14%) | ||
WD40 repeat | 386..426 | CDD:293791 | |||
WD40 repeat | 433..457 | CDD:293791 | |||
LST8 | NP_014392.3 | WD40 | 4..278 | CDD:238121 | 47/205 (23%) |
WD40 repeat | 36..73 | CDD:293791 | 54/230 (23%) | ||
WD40 repeat | 78..114 | CDD:293791 | 10/35 (29%) | ||
WD40 repeat | 120..155 | CDD:293791 | 9/34 (26%) | ||
WD40 repeat | 162..204 | CDD:293791 | 1/41 (2%) | ||
WD40 repeat | 210..247 | CDD:293791 | 10/36 (28%) | ||
WD40 repeat | 253..277 | CDD:293791 | 7/23 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG53955 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |