| Sequence 1: | NP_572778.1 | Gene: | Tango4 / 32168 | FlyBaseID: | FBgn0030365 | Length: | 482 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_013764.1 | Gene: | ERB1 / 855068 | SGDID: | S000004652 | Length: | 807 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 406 | Identity: | 78/406 - (19%) |
|---|---|---|---|
| Similarity: | 124/406 - (30%) | Gaps: | 163/406 - (40%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 151 PSIPKPKWHAPW--KLSRVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLT-- 211
Fly 212 -------GHVSTVR----------GVAVSTK-H---PYLFSC----------------------- 232
Fly 233 ---------------GEDRQVK----------------------CWDLEYNKVIRHYHGHLSAVY 260
Fly 261 SLALHPTIDVLATSGRDST----------------------------------------ARIWDM 285
Fly 286 RTKANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLW---DLAAGKSVCTLTNHKKSVRSIV 347
Fly 348 LHPSLYMFASASPDNI----------KQWRCPEGKFVQNISGHTSIVNCMAANSEGV-------- 394
Fly 395 ---LVSGGDNGTMFFW 407 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tango4 | NP_572778.1 | WD40 | <161..458 | CDD:225201 | 74/396 (19%) |
| WD40 | 164..458 | CDD:238121 | 73/391 (19%) | ||
| WD40 repeat | 177..212 | CDD:293791 | 9/43 (21%) | ||
| WD40 repeat | 218..254 | CDD:293791 | 11/109 (10%) | ||
| WD40 repeat | 259..295 | CDD:293791 | 9/75 (12%) | ||
| WD40 repeat | 302..337 | CDD:293791 | 10/37 (27%) | ||
| WD40 repeat | 343..378 | CDD:293791 | 10/44 (23%) | ||
| WD40 repeat | 386..426 | CDD:293791 | 9/33 (27%) | ||
| WD40 repeat | 433..457 | CDD:293791 | |||
| ERB1 | NP_013764.1 | BOP1NT | 165..426 | CDD:400453 | 5/11 (45%) |
| WD40 | 429..805 | CDD:421866 | 72/389 (19%) | ||
| WD40 repeat | 441..483 | CDD:293791 | 10/41 (24%) | ||
| WD40 repeat | 488..540 | CDD:293791 | 6/51 (12%) | ||
| WD40 repeat | 598..637 | CDD:293791 | 6/44 (14%) | ||
| WD40 repeat | 642..676 | CDD:293791 | 4/33 (12%) | ||
| WD40 repeat | 684..720 | CDD:293791 | 10/37 (27%) | ||
| WD40 repeat | 726..771 | CDD:293791 | 10/44 (23%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||