DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and SWD3

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_009734.1 Gene:SWD3 / 852472 SGDID:S000000379 Length:315 Species:Saccharomyces cerevisiae


Alignment Length:254 Identity:57/254 - (22%)
Similarity:111/254 - (43%) Gaps:24/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 CIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSL-TGHVSTVRGVAVSTKHPYLFSCGEDRQVKC 240
            |..:.|..::.|...|..:: |:|:....:..:| |.|......:..|.....:.:..:|..|:.
Yeast    18 CAKISPDGQFLAITQGLNIL-IYDINRRTVSQTLVTSHARPFSELCWSPDGQCIATASDDFSVEI 81

  Fly   241 WDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGHTNTVASVV 305
            ..|.|. ::..:.||.:.|.||..:...::|.||..|.:.:|||....:.:.|::.|:..|.||.
Yeast    82 IHLSYG-LLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVD 145

  Fly   306 AQATNPQII-TGSHDSTVRLWDLAAGKSVCTLTNHKKSVRSIVLHP---------SLYMFASASP 360
            ....:..|: :||:|..:|::|...|..:.|||..|...|...:.|         :.|:...:..
Yeast   146 VPMNDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLLVKSLD 210

  Fly   361 DNIKQWRCPEGKFV---------QNISGHTSIVNCM--AANSEGVLVSGGDNGTMFFWD 408
            ..:|.|.|..|..|         :.:..|:..::.:  ...|..:::||.:||.::.|:
Yeast   211 GVVKIWDCIGGCVVRTFQVQPLEKGVLHHSCGMDFLNPEDGSTPLVISGYENGDIYCWN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 57/254 (22%)
WD40 164..458 CDD:238121 57/254 (22%)
WD40 repeat 177..212 CDD:293791 7/35 (20%)
WD40 repeat 218..254 CDD:293791 5/35 (14%)
WD40 repeat 259..295 CDD:293791 11/35 (31%)
WD40 repeat 302..337 CDD:293791 10/35 (29%)
WD40 repeat 343..378 CDD:293791 8/52 (15%)
WD40 repeat 386..426 CDD:293791 6/25 (24%)
WD40 repeat 433..457 CDD:293791
SWD3NP_009734.1 WD40 17..314 CDD:238121 57/254 (22%)
WD40 repeat 17..53 CDD:293791 7/35 (20%)
WD40 repeat 59..94 CDD:293791 5/35 (14%)
WD40 repeat 99..135 CDD:293791 11/35 (31%)
WD40 repeat 142..178 CDD:293791 10/35 (29%)
WD40 repeat 192..228 CDD:293791 6/35 (17%)
WD40 repeat 236..284 CDD:293791 7/34 (21%)
WD40 repeat 290..312 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.