DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and PWP2

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_009984.1 Gene:PWP2 / 850422 SGDID:S000000653 Length:923 Species:Saccharomyces cerevisiae


Alignment Length:423 Identity:84/423 - (19%)
Similarity:154/423 - (36%) Gaps:93/423 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 AIASHLQLIPKKAPSIPKPKWHAPWKLSRVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLA 202
            |:||...|...|.|.:.|.:..||:...||.:||...:..:.....:.:..|.:.|...|||.:.
Yeast   112 ALASGRFLQIWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVD 176

  Fly   203 SGKLKLSLT---GHVSTVRGVAVSTKHPYLFSCGEDRQVKCWDL--------------------- 243
            |.:..|:.|   ||...|.|...|.....:::..:|..|..|:.                     
Yeast   177 SEEKNLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEFTKRPSDDDDNESEDDDKQEEV 241

  Fly   244 ---EYNKVI--RH-YHGHLSAVYSLALHPTIDVLATSGRDSTARIWDM----------------- 285
               :|:..|  :| ::.:.:.|..:..||...:||........|::|:                 
Yeast   242 DISKYSWRITKKHFFYANQAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQLSMGQNPVN 306

  Fly   286 --------------------------RTKANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRL 324
                                      ::::.:....||.::..|:.......:::|.|.|..:::
Yeast   307 TVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKV 371

  Fly   325 WDLAAGKSVCTLTNHKKSVRSI-VLHPSLYMFASASPDNIKQWRCPEGKFVQNISGHTSI-VNCM 387
            ||:.:|..:.|...|..||.:: .......||:|:....::.|.....:..:..:|...| .||:
Yeast   372 WDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCL 436

  Fly   388 AANSEGVLVSGG--DNGTMFFWDWRTGYNFQRFQAPVQPGSMDSEAGIFAMCFDQSGSRLITAEA 450
            |.:..|.:|..|  ||..:..|..:||........        .|..:..:.|.|..|.|.:|..
Yeast   437 AVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSG--------HEGPVSCLSFSQENSVLASASW 493

  Fly   451 DKTIKVYK--------EDDEASEESHPINWRPD 475
            ||||:::.        |..|...:...::.|||
Yeast   494 DKTIRIWSIFGRSQQVEPIEVYSDVLALSMRPD 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 71/373 (19%)
WD40 164..458 CDD:238121 70/370 (19%)
WD40 repeat 177..212 CDD:293791 8/37 (22%)
WD40 repeat 218..254 CDD:293791 8/62 (13%)
WD40 repeat 259..295 CDD:293791 7/78 (9%)
WD40 repeat 302..337 CDD:293791 8/34 (24%)
WD40 repeat 343..378 CDD:293791 5/35 (14%)
WD40 repeat 386..426 CDD:293791 10/41 (24%)
WD40 repeat 433..457 CDD:293791 9/23 (39%)
PWP2NP_009984.1 WD40 repeat 58..94 CDD:293791
WD40 repeat 99..144 CDD:293791 11/31 (35%)
WD40 139..501 CDD:238121 70/369 (19%)
WD40 repeat 150..189 CDD:293791 8/38 (21%)
WD40 repeat 194..220 CDD:293791 6/25 (24%)
WD40 repeat 265..300 CDD:293791 6/34 (18%)
WD40 repeat 306..343 CDD:293791 0/36 (0%)
WD40 330..>718 CDD:225201 45/205 (22%)
WD40 repeat 348..384 CDD:293791 8/35 (23%)
WD40 repeat 391..426 CDD:293791 4/34 (12%)
WD40 repeat 433..470 CDD:293791 11/36 (31%)
WD40 repeat 476..513 CDD:293791 10/36 (28%)
WD40 repeat 518..542 CDD:293791 3/9 (33%)
WD40 repeat 580..616 CDD:293791
Utp12 746..851 CDD:397900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.