DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and BPH1

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_009961.2 Gene:BPH1 / 850398 SGDID:S000000628 Length:2167 Species:Saccharomyces cerevisiae


Alignment Length:240 Identity:42/240 - (17%)
Similarity:80/240 - (33%) Gaps:57/240 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 APWKLSRVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWDL------ASGKL--KLSLTGHVST 216
            |.|||..                    |.||..:.:||:|..      .||.|  |.::.||:..
Yeast  1936 AYWKLGE--------------------FITGDKNGLIKVWKYRKDKHSVSGNLENKKTMFGHLCE 1980

  Fly   217 VRGVAVSTKHPYLFSCGEDRQVKCWDLEYNKVIRHYHG---------HLSAVYSLALHPTIDVLA 272
            ::.:.....:..|.:......|..||:...:::|....         |..::..|..:..|.:..
Yeast  1981 LKEMRCYHDYNTLLTLDISGLVYVWDMINFELVRQITNDAQKVAISQHAGSIMVLTKNNAISIFN 2045

  Fly   273 TSGRDSTARIWDMRTKANVHTLTGHTNTVASV---VAQATNPQIITGSHDSTVRL---------- 324
            .:|:..|::.::.....:.......|...|..   :.......::.|..|.|:.:          
Yeast  2046 LNGQIYTSKKFEPAKIVSSIDFFDFTKLDAGYRKHIYWKEMEILLVGFEDGTIEIYELFLNFHNE 2110

  Fly   325 WDLAAGKSVCTLTNHKKSVRSIVLHPSLYMFA-----SASPDNIK 364
            |.:...|.:|  |...|::.||......|:..     :|.|..|:
Yeast  2111 WAIKLLKQLC--TEKGKAITSIKGQGKTYLSQKRRKDTAEPHEIE 2153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 41/239 (17%)
WD40 164..458 CDD:238121 39/236 (17%)
WD40 repeat 177..212 CDD:293791 10/42 (24%)
WD40 repeat 218..254 CDD:293791 5/35 (14%)
WD40 repeat 259..295 CDD:293791 4/35 (11%)
WD40 repeat 302..337 CDD:293791 7/47 (15%)
WD40 repeat 343..378 CDD:293791 6/27 (22%)
WD40 repeat 386..426 CDD:293791
WD40 repeat 433..457 CDD:293791
BPH1NP_009961.2 PH_BEACH 1371..1500 CDD:275391
Beach 1558..1839 CDD:214982
WD40 repeat 1933..1976 CDD:293791 14/59 (24%)
WD40 repeat 1981..2017 CDD:293791 5/35 (14%)
WD40 repeat 2021..2055 CDD:293791 5/33 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.