DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and WDR24

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_011521001.1 Gene:WDR24 / 84219 HGNCID:20852 Length:879 Species:Homo sapiens


Alignment Length:398 Identity:89/398 - (22%)
Similarity:135/398 - (33%) Gaps:110/398 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 HTSLVRASLANSNADMSANGAIASHLQLIPKKAPSIPKPKWHAPWKLSRVISGHLGWVRCIAVEP 182
            |.|.....:  .:|:.:||.|....||:....||.   |:              |.|..|:|...
Human   185 HHSFAHGPM--QDAESTANDAREYVLQITWCPAPG---PR--------------LLWRLCVAASL 230

  Fly   183 GNEW----FATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKHPYLF-SCGEDRQVKCWD 242
            |..|    :..|          |.||    ...|...:||.|..|.:..:.| |..|:..|:.||
Human   231 GRSWGCPLYPLG----------LCSG----PQAGQSESVRDVQFSIRDYFTFASTFENGNVQLWD 281

  Fly   243 LEY-NKVIRHYHGHLSAVYSLALHP-TIDVLATSGRDSTARIWDMRT--KANVHTLTGHTNTVAS 303
            :.. ::..|.:..|...|:....|| ....|||.|||...::|||.|  ...:|.:    .|:||
Human   282 IRRPDRCERMFTAHNGPVFCCDWHPEDRGWLATGGRDKMVKVWDMTTHRAKEMHCV----QTIAS 342

  Fly   304 VVAQATNPQ----IITGSH--DSTVRLWDLAAGKSVCTLTNHKKSVRSIVLHPSLYMFASASPDN 362
            |......|:    :.|.|.  |..:.:||:........:....:.|.:.:               
Human   343 VARVKWRPECRHHLATCSMMVDHNIYVWDVRRPFVPAAMFEEHRDVTTGI--------------- 392

  Fly   363 IKQWRCP-EGKFVQNISGHTSIVNCM---------AANSEGV---------------LVSGGDNG 402
              .||.| :..|:.:.|..:|:...:         .||.||:               ||:.....
Human   393 --AWRHPHDPSFLLSGSKDSSLCQHLFRDASQPVERANPEGLCYGLFGDLAFAAKESLVAAESGR 455

  Fly   403 TMFFWDWRTGYNFQRFQAPVQP--GSMDSEAGIFAMCFDQSGSR--LITAE------------AD 451
            ..:..|.|....|:|...|.:|  |...|...:|.......|.|  :.|||            .|
Human   456 KPYTGDRRHPIFFKRKLDPAEPFAGLASSALSVFETEPGGGGMRWFVDTAERYALAGRPLAELCD 520

  Fly   452 KTIKVYKE 459
            ...||.:|
Human   521 HNAKVARE 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 77/352 (22%)
WD40 164..458 CDD:238121 77/349 (22%)
WD40 repeat 177..212 CDD:293791 8/38 (21%)
WD40 repeat 218..254 CDD:293791 10/37 (27%)
WD40 repeat 259..295 CDD:293791 14/38 (37%)
WD40 repeat 302..337 CDD:293791 9/40 (23%)
WD40 repeat 343..378 CDD:293791 5/35 (14%)
WD40 repeat 386..426 CDD:293791 12/65 (18%)
WD40 repeat 433..457 CDD:293791 8/37 (22%)
WDR24XP_011521001.1 WD40 40..412 CDD:225201 64/280 (23%)
WD40 repeat 74..118 CDD:293791
WD40 86..412 CDD:295369 64/280 (23%)
WD40 repeat 123..160 CDD:293791
WD40 repeat 177..245 CDD:293791 19/88 (22%)
WD40 repeat 255..293 CDD:293791 11/37 (30%)
WD40 repeat 299..341 CDD:293791 15/45 (33%)
WD40 repeat 343..370 CDD:293791 5/26 (19%)
WD40 repeat 389..413 CDD:293791 6/40 (15%)
Zn_ribbon_17 831..876 CDD:305234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.