DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and HOS15

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_201533.1 Gene:HOS15 / 836867 AraportID:AT5G67320 Length:613 Species:Arabidopsis thaliana


Alignment Length:507 Identity:112/507 - (22%)
Similarity:183/507 - (36%) Gaps:149/507 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EIDERLEKLRRSIKAKDGYGLVLDKVAKIGEARKASGAQT---------PGDKTLAI--TDGS-A 87
            |.:...||:.|.|..::...|.|:|..:|...|:....:.         ..|:.:.|  ||.. |
plant   166 EKEREREKMEREIFEREKDRLKLEKEREIEREREREKIEREKSHEKQLGDADREMVIDQTDKEIA 230

  Fly    88 TDAASGAGSLVKYNAGARPAEKTAPL------VTGTHTSLVRASLANSNADMSANGA--IASHLQ 144
            .|.::||..:   :....|..:|:.:      :...|||.|.|...:.:|.:.|:|:  ..:.:.
plant   231 GDGSTGAEPM---DIVMTPTSQTSHIPNSDVRILEGHTSEVCACAWSPSASLLASGSGDATARIW 292

  Fly   145 LIPK--------------------KAPSIPKPK-------------------------WHAPWKL 164
            .||:                    |..|..|.|                         |....:|
plant   293 SIPEGSFKAVHTGRNINALILKHAKGKSNEKSKDVTTLDWNGEGTLLATGSCDGQARIWTLNGEL 357

  Fly   165 SRVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGH------VSTVRGVAVS 223
            ...:|.|.|.:..:......::..||:.||...:||:.:.:.|.....|      |.....|:.:
plant   358 ISTLSKHKGPIFSLKWNKKGDYLLTGSVDRTAVVWDVKAEEWKQQFEFHSGPTLDVDWRNNVSFA 422

  Fly   224 TKHP----YLFSCGEDRQVKCWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTARIWD 284
            |...    ||...||.|..|.           :.||...|..:...||..:||:...||||:||:
plant   423 TSSTDSMIYLCKIGETRPAKT-----------FTGHQGEVNCVKWDPTGSLLASCSDDSTAKIWN 476

  Fly   285 MRTKANVHTLTGHTNTVASVVAQATNP---------QIITGSHDSTVRLWDLAAGKSVCTLTNHK 340
            ::....||.|..||..:.::....|.|         .:.:.|.||||:|||...||.:|:...|:
plant   477 IKQSTFVHDLREHTKEIYTIRWSPTGPGTNNPNKQLTLASASFDSTVKLWDAELGKMLCSFNGHR 541

  Fly   341 KSVRSIVLHPSLYMFASASPD-NIKQWRCPEGKFVQNISGHTSIVNCMAANSEGVLVSGGDNGTM 404
            :.|.|:...|:....||.|.| :|..|...|||.|:..:|                     ||  
plant   542 EPVYSLAFSPNGEYIASGSLDKSIHIWSIKEGKIVKTYTG---------------------NG-- 583

  Fly   405 FFWDWRTGYNFQRFQAPVQPGSMDSEAGIFAMCFDQSGSRLITAEADKTIKV 456
                                       |||.:|:::.|:::....||.::.|
plant   584 ---------------------------GIFEVCWNKEGNKIAACFADNSVCV 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 77/316 (24%)
WD40 164..458 CDD:238121 77/313 (25%)
WD40 repeat 177..212 CDD:293791 7/34 (21%)
WD40 repeat 218..254 CDD:293791 8/39 (21%)
WD40 repeat 259..295 CDD:293791 13/35 (37%)
WD40 repeat 302..337 CDD:293791 13/43 (30%)
WD40 repeat 343..378 CDD:293791 13/35 (37%)
WD40 repeat 386..426 CDD:293791 2/39 (5%)
WD40 repeat 433..457 CDD:293791 7/24 (29%)
HOS15NP_201533.1 LisH 8..32 CDD:369916
WD40 258..569 CDD:238121 76/321 (24%)
WD40 repeat 269..313 CDD:293791 6/43 (14%)
WD40 repeat 327..363 CDD:293791 2/35 (6%)
WD40 repeat 369..405 CDD:293791 7/35 (20%)
WD40 repeat 410..445 CDD:293791 9/45 (20%)
WD40 repeat 452..487 CDD:293791 12/34 (35%)
WD40 repeat 493..538 CDD:293791 13/44 (30%)
WD40 repeat 544..580 CDD:293791 13/35 (37%)
WD40 repeat 585..608 CDD:293791 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.