DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and AT5G08390

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_568194.2 Gene:AT5G08390 / 830737 AraportID:AT5G08390 Length:839 Species:Arabidopsis thaliana


Alignment Length:250 Identity:70/250 - (28%)
Similarity:116/250 - (46%) Gaps:3/250 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 WKLSRVISGHLGWVRCIAV-EPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTK 225
            :||...:: |...|.|:.: ...:....||..|..:.:|.:......|||.||.|.:..|.....
plant     7 YKLQEFVA-HSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSSGIDSVTFDAS 70

  Fly   226 HPYLFSCGEDRQVKCWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKAN 290
            ...:.:......:|.||||..||:|...||.|...|:..||..:..|:...|:..:|||:|.|..
plant    71 EGLVAAGAASGTIKLWDLEEAKVVRTLTGHRSNCVSVNFHPFGEFFASGSLDTNLKIWDIRKKGC 135

  Fly   291 VHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKSVCTLTNHKKSVRSIVLHPSLYMF 355
            :||..|||..|..:........|::|..|:.|::|||.|||.:....:|:..::|:..||..::.
plant   136 IHTYKGHTRGVNVLRFTPDGRWIVSGGEDNVVKVWDLTAGKLLHEFKSHEGKIQSLDFHPHEFLL 200

  Fly   356 ASASPD-NIKQWRCPEGKFVQNISGHTSIVNCMAANSEGVLVSGGDNGTMFFWDW 409
            |:.|.| .:|.|.....:.:.:....|:.|.|:..|.:|..|..|...::..:.|
plant   201 ATGSADKTVKFWDLETFELIGSGGTETTGVRCLTFNPDGKSVLCGLQESLKIFSW 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 69/249 (28%)
WD40 164..458 CDD:238121 68/247 (28%)
WD40 repeat 177..212 CDD:293791 8/35 (23%)
WD40 repeat 218..254 CDD:293791 9/35 (26%)
WD40 repeat 259..295 CDD:293791 12/35 (34%)
WD40 repeat 302..337 CDD:293791 10/34 (29%)
WD40 repeat 343..378 CDD:293791 8/35 (23%)
WD40 repeat 386..426 CDD:293791 5/23 (22%)
WD40 repeat 433..457 CDD:293791
AT5G08390NP_568194.2 WD40 9..261 CDD:238121 68/247 (28%)
WD40 repeat 63..99 CDD:293791 9/35 (26%)
WD40 repeat 104..140 CDD:293791 12/35 (34%)
WD40 repeat 147..182 CDD:293791 10/34 (29%)
WD40 repeat 188..222 CDD:293791 8/33 (24%)
Katanin_con80 680..831 CDD:404758
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.