DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and SPA2

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_192849.4 Gene:SPA2 / 826712 AraportID:AT4G11110 Length:1036 Species:Arabidopsis thaliana


Alignment Length:482 Identity:97/482 - (20%)
Similarity:179/482 - (37%) Gaps:125/482 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IFRSLKRTHDLFVSNQ--GNLPEIDERLEKLRRSIKAKDGYGLVLDKVAKIGEARKASGAQTPGD 77
            :.|::.:....:.:.:  .:|||...||...|..::..|      :.||::    :.|...:..|
plant   636 LIRNINQLESAYFAARIDAHLPEARYRLRPDRDLLRNSD------NTVAEV----ENSETWSSDD 690

  Fly    78 KTLAITDGSATDAASGAGSLVKY----NAGARPAEKTAPLVTGTHTSLVRASLA-NSNADMSANG 137
            :..|..||           |.||    ....|...:|:.|   .:||.|..||. :.:.|..|..
plant   691 RVGAFFDG-----------LCKYARYSKFETRGVLRTSEL---NNTSNVICSLGFDRDEDYFATA 741

  Fly   138 AIASHLQL----------IPKKAPSIPKPKWHAPWKLSRVISGHLGWVRCIAVEPGNEWFATGAG 192
            .::..:::          :....|:|..|...   |||.|.     |...|     ..:.|:...
plant   742 GVSKKIKIYEFNSLFNESVDIHYPAIEMPNRS---KLSGVC-----WNNYI-----RNYLASSDY 793

  Fly   193 DRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKHPYLFSCG-EDRQVKCWDLEYNK---VIRHYH 253
            |.::|:||:.:|:.......|......|..|...|...:.| :|..||.|::....   .||   
plant   794 DGIVKLWDVTTGQAISHFIEHEKRAWSVDFSEACPTKLASGSDDCSVKLWNINERNCLGTIR--- 855

  Fly   254 GHLSAVYSLALHP-TIDVLATSGRDSTARIWDMRTKANVHT----LTGHTNTVASVVAQATNPQI 313
             :::.|..:...| :..:||....|.....:|:|   |:.|    |:|| |...|......|..:
plant   856 -NIANVCCVQFSPQSSHLLAFGSSDFRTYCYDLR---NLRTPWCILSGH-NKAVSYAKFLDNETL 915

  Fly   314 ITGSHDSTVRLWDL------AAGKSVCTLTNHKKSVRSIVLHPSLYMFASASPDNIKQWRCPEGK 372
            :|.|.|:|::||||      ....:.|:||                                   
plant   916 VTASTDNTLKLWDLKKTTHGGLSTNACSLT----------------------------------- 945

  Fly   373 FVQNISGHTSIVNCMA-ANSEGVLVSGGDNGTMFFWDWR-----TGYNFQRFQAPVQPGSMDSEA 431
                ..|||:..|.:. :.|:|.:..|.:...::.:...     |.|.|.... |:....::.:.
plant   946 ----FGGHTNEKNFVGLSTSDGYIACGSETNEVYAYHRSLPMPITSYKFGSID-PISGKEIEEDN 1005

  Fly   432 GIF--AMCFDQSGSRLITAEADKTIKV 456
            .:|  ::|:.:..:.:::|.::.:|||
plant  1006 NLFVSSVCWRKRSNMVVSASSNGSIKV 1032

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 66/319 (21%)
WD40 164..458 CDD:238121 65/316 (21%)
WD40 repeat 177..212 CDD:293791 7/34 (21%)
WD40 repeat 218..254 CDD:293791 10/39 (26%)
WD40 repeat 259..295 CDD:293791 9/40 (23%)
WD40 repeat 302..337 CDD:293791 11/40 (28%)
WD40 repeat 343..378 CDD:293791 0/34 (0%)
WD40 repeat 386..426 CDD:293791 7/45 (16%)
WD40 repeat 433..457 CDD:293791 6/26 (23%)
SPA2NP_192849.4 PLN00181 299..1036 CDD:177776 97/482 (20%)
PKc_like <299..548 CDD:304357
WD40 723..1032 CDD:238121 73/369 (20%)
WD40 repeat 726..769 CDD:293791 6/42 (14%)
WD40 repeat 776..813 CDD:293791 10/46 (22%)
WD40 repeat 818..855 CDD:293791 8/36 (22%)
WD40 repeat 861..897 CDD:293791 8/38 (21%)
WD40 repeat 904..947 CDD:293791 13/81 (16%)
WD40 repeat 954..1002 CDD:293791 8/48 (17%)
WD40 repeat 1009..1032 CDD:293791 3/22 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.