DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and DWA1

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_849989.1 Gene:DWA1 / 816462 AraportID:AT2G19430 Length:367 Species:Arabidopsis thaliana


Alignment Length:265 Identity:70/265 - (26%)
Similarity:106/265 - (40%) Gaps:56/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 LFSCGEDRQVKCW---DLEYNKVIRHY-HGHLSAVYSL----------ALHPTIDVLA------- 272
            |.|||:|.:|:.|   :...:.|..|. ..||..:..|          ||.|..::.|       
plant   107 LLSCGDDGRVRGWKWREFAESDVSLHLKENHLKPLLELINPQHKGPWGALSPMPEINAMSVDPQS 171

  Fly   273 ----TSGRDSTARIWDMRTKANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKSV 333
                |:..||.|..||:.:.....|..||::.:.:||::::..||:|||.|.|.|:||...||.|
plant   172 GSVFTAAGDSCAYCWDVESGKIKMTFKGHSDYLHTVVSRSSASQILTGSEDGTARIWDCKTGKCV 236

  Fly   334 CTL-TNHKKS---VRSIVLHPSLYMFASASPDNIKQWRCPEGKFVQNISGHTSIVNCMAANSEGV 394
            ..: :..|||   |.|:.|..|..........|:..|..|..:.||.|.....:.:.| .:.:.:
plant   237 KVIGSQDKKSRLRVSSMALDGSESWLVCGQGKNLALWNLPASECVQTIPIPAHVQDVM-FDEKQI 300

  Fly   395 LVSGGD--------NGTMFFWDWRTGYNFQRFQAPVQPGSMD-SEAGIFAM--------CFDQSG 442
            |..|.:        ||.:.         .|...||....|:. ..||:.|:        ...|.|
plant   301 LTVGAEPLLRRFDLNGALL---------SQIHCAPCSVFSISLHPAGVVAVGGYGGIVDVISQFG 356

  Fly   443 SRLIT 447
            |.|.|
plant   357 SHLCT 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 70/265 (26%)
WD40 164..458 CDD:238121 70/265 (26%)
WD40 repeat 177..212 CDD:293791
WD40 repeat 218..254 CDD:293791 9/28 (32%)
WD40 repeat 259..295 CDD:293791 12/56 (21%)
WD40 repeat 302..337 CDD:293791 15/35 (43%)
WD40 repeat 343..378 CDD:293791 9/34 (26%)
WD40 repeat 386..426 CDD:293791 8/47 (17%)
WD40 repeat 433..457 CDD:293791 6/23 (26%)
DWA1NP_849989.1 WD40 repeat 26..88 CDD:293791
WD40 40..306 CDD:421866 56/199 (28%)
WD40 repeat 163..199 CDD:293791 8/35 (23%)
WD40 repeat 204..240 CDD:293791 15/35 (43%)
WD40 repeat 251..285 CDD:293791 8/33 (24%)
WD40 repeat 292..321 CDD:293791 5/38 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.