| Sequence 1: | NP_572778.1 | Gene: | Tango4 / 32168 | FlyBaseID: | FBgn0030365 | Length: | 482 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_077360.2 | Gene: | Thoc6 / 79227 | RGDID: | 708553 | Length: | 341 | Species: | Rattus norvegicus |
| Alignment Length: | 256 | Identity: | 56/256 - (21%) |
|---|---|---|---|
| Similarity: | 98/256 - (38%) | Gaps: | 61/256 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 179 AVEPGNEWFATGAGDRVIKIWDLA----------SGKLKLSLTGHVSTVRGVAVSTKHPYLFSCG 233
Fly 234 EDRQVKCWDLEYNKVIRH-----------YHGHLSA--VYSLALHPTIDVLATSGRDSTARIWDM 285
Fly 286 RTKANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKSVCTLTNHKKSVRSIVLHP 350
Fly 351 SLYMFASASPDNIKQWRCPEGKFVQNISGHTSIVNCMAANSEGVLVSGGDNGTMFFWDWRT 411 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tango4 | NP_572778.1 | WD40 | <161..458 | CDD:225201 | 56/256 (22%) |
| WD40 | 164..458 | CDD:238121 | 56/256 (22%) | ||
| WD40 repeat | 177..212 | CDD:293791 | 9/42 (21%) | ||
| WD40 repeat | 218..254 | CDD:293791 | 9/46 (20%) | ||
| WD40 repeat | 259..295 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 302..337 | CDD:293791 | 12/34 (35%) | ||
| WD40 repeat | 343..378 | CDD:293791 | 3/34 (9%) | ||
| WD40 repeat | 386..426 | CDD:293791 | 8/26 (31%) | ||
| WD40 repeat | 433..457 | CDD:293791 | |||
| Thoc6 | NP_077360.2 | WD 1 | 22..61 | 7/29 (24%) | |
| WD40 | 27..285 | CDD:421866 | 56/256 (22%) | ||
| WD40 repeat | 28..74 | CDD:293791 | 9/42 (21%) | ||
| WD 2 | 74..112 | 10/42 (24%) | |||
| WD40 repeat | 79..115 | CDD:293791 | 9/40 (23%) | ||
| WD 3 | 124..163 | 9/38 (24%) | |||
| WD40 repeat | 130..165 | CDD:293791 | 8/34 (24%) | ||
| WD 4 | 166..205 | 14/38 (37%) | |||
| WD40 repeat | 171..210 | CDD:293791 | 12/52 (23%) | ||
| WD 5 | 215..254 | 10/53 (19%) | |||
| WD40 repeat | 218..260 | CDD:293791 | 9/50 (18%) | ||
| WD 6 | 256..293 | ||||
| WD 7 | 295..339 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||