DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and STRN

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_011531375.1 Gene:STRN / 6801 HGNCID:11424 Length:809 Species:Homo sapiens


Alignment Length:475 Identity:100/475 - (21%)
Similarity:156/475 - (32%) Gaps:154/475 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KRTHDLF-------VSNQG---------------------NLPEIDERLEKLRRSIKAKDGYGLV 56
            |.|.|||       .|.||                     ||.::|| |..|:.|          
Human   349 KTTEDLFQPLSYIKQSKQGCGRMKNQSLGPNRSKLQDMLANLRDVDE-LPSLQPS---------- 402

  Fly    57 LDKVAKIGEARKASGAQTP------GDKTLAIT--DGSATDAASGAGSLVKYNAGARPAEKTAPL 113
                  :|...:.|.::.|      .|:..|:|  ..|......||...::...|   ..:.|.|
Human   403 ------VGSPSRPSSSRLPEHEINRADEVEALTFPPSSGKSFIMGADEALESELG---LGELAGL 458

  Fly   114 VTGTHTSLVRASLANSNAD-----MSANGAIASHLQLIPKKAPSIPKP------------KWH-- 159
            ........:...:|| |.|     .:....:.||...|...|....:|            .|:  
Human   459 TVANEADSLTYDIAN-NKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQ 522

  Fly   160 --APWKLSRVIS--------GHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLAS----------- 203
              ||.|.|..:.        .|.|.|.|:.:....|...:|..|.:|:.|:..:           
Human   523 KTAPAKKSTSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNIDPYDSYDP 587

  Fly   204 GKLKLSLTGHVSTVRGVAVSTKHPYLFSCGEDRQVKCWDLE--------YN-----------KVI 249
            ..|:..|.||...|.|:|.|..|..|.||..|..::.|:..        :|           .::
Human   588 SVLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWNTTEVAPALSVFNDTKELGIPASVDLV 652

  Fly   250 RHYHGHLSAVYS---------------LAL-------------------HPTIDVLATSGRDSTA 280
            .....|:.|.:|               |.|                   |||:.:..|:..|...
Human   653 SSDPSHMVASFSKGYTSIFNMETQQRILTLESNVDTTANSSCQINRVISHPTLPISITAHEDRHI 717

  Fly   281 RIWDMRTKANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKSVCTLTNHKK---- 341
            :.:|..|...:|::..|...|.|:........:::||||.::|||:|.:...:...|.|:|    
Human   718 KFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEE 782

  Fly   342 SVRSIVLHPSLYMFASASPD 361
            |:..:..|||....|||..|
Human   783 SIHDVAFHPSKCYIASAGAD 802

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 62/277 (22%)
WD40 164..458 CDD:238121 60/274 (22%)
WD40 repeat 177..212 CDD:293791 8/45 (18%)
WD40 repeat 218..254 CDD:293791 10/54 (19%)
WD40 repeat 259..295 CDD:293791 11/69 (16%)
WD40 repeat 302..337 CDD:293791 9/34 (26%)
WD40 repeat 343..378 CDD:293791 7/19 (37%)
WD40 repeat 386..426 CDD:293791
WD40 repeat 433..457 CDD:293791
STRNXP_011531375.1 Striatin 48..173 CDD:285445
WD40 458..>802 CDD:225201 73/344 (21%)
WD40 484..808 CDD:238121 69/319 (22%)
WD40 repeat 497..543 CDD:293791 7/45 (16%)
WD40 repeat 549..596 CDD:293791 8/46 (17%)
WD40 repeat 601..637 CDD:293791 10/35 (29%)
WD40 repeat 645..683 CDD:293791 4/37 (11%)
WD40 repeat 696..732 CDD:293791 8/35 (23%)
WD40 repeat 738..774 CDD:293791 10/35 (29%)
WD40 repeat 784..808 CDD:293791 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.