| Sequence 1: | NP_572778.1 | Gene: | Tango4 / 32168 | FlyBaseID: | FBgn0030365 | Length: | 482 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006712761.1 | Gene: | NBEAL1 / 65065 | HGNCID: | 20681 | Length: | 2736 | Species: | Homo sapiens |
| Alignment Length: | 227 | Identity: | 60/227 - (26%) |
|---|---|---|---|
| Similarity: | 90/227 - (39%) | Gaps: | 55/227 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 146 IPKKAPSIPK-----------PKWHAPWKLSRVISGHLGWV---RCIAVEPGNEWFATGAGDRVI 196
Fly 197 KIWDLASGKLKLSLTGHVSTVRGVAVSTK-----H--PYLFSCGE-DRQVKCWDLEYNKVIRHYH 253
Fly 254 GHLSAVYSLA-----LHPTIDVLATSGRDSTARIWDMRTKANV---------HTLTGHTNTVASV 304
Fly 305 VAQATNPQIITGSHDSTVRLWDLAAGKSVCTL 336 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tango4 | NP_572778.1 | WD40 | <161..458 | CDD:225201 | 54/201 (27%) |
| WD40 | 164..458 | CDD:238121 | 54/198 (27%) | ||
| WD40 repeat | 177..212 | CDD:293791 | 6/34 (18%) | ||
| WD40 repeat | 218..254 | CDD:293791 | 12/43 (28%) | ||
| WD40 repeat | 259..295 | CDD:293791 | 11/49 (22%) | ||
| WD40 repeat | 302..337 | CDD:293791 | 10/35 (29%) | ||
| WD40 repeat | 343..378 | CDD:293791 | |||
| WD40 repeat | 386..426 | CDD:293791 | |||
| WD40 repeat | 433..457 | CDD:293791 | |||
| NBEAL1 | XP_006712761.1 | DUF4704 | 888..1148 | CDD:292415 | |
| DUF4800 | 1609..1862 | CDD:292675 | |||
| PH_BEACH | 1915..2012 | CDD:275391 | |||
| Beach | 2034..2313 | CDD:280327 | |||
| WD40 | <2390..2699 | CDD:225201 | 50/188 (27%) | ||
| WD40 repeat | 2435..2468 | CDD:293791 | 10/32 (31%) | ||
| WD40 | 2438..2682 | CDD:295369 | 37/127 (29%) | ||
| WD40 repeat | 2474..2519 | CDD:293791 | 11/49 (22%) | ||
| WD40 repeat | 2524..2560 | CDD:293791 | 11/36 (31%) | ||
| WD40 repeat | 2572..2606 | CDD:293791 | |||
| WD40 repeat | 2619..2654 | CDD:293791 | |||
| WD40 repeat | 2659..2699 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||