DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and WDFY4

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_011538288.2 Gene:WDFY4 / 57705 HGNCID:29323 Length:3224 Species:Homo sapiens


Alignment Length:355 Identity:78/355 - (21%)
Similarity:123/355 - (34%) Gaps:84/355 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HDLFVSNQGNLPEIDERLEKLRRSIKAKDGYGLVLDKVAKIGE-----------ARKASGAQTPG 76
            |..|..::.:|..|.:.|.|           ..:|..|:..|:           ||.|:|...||
Human  2817 HPYFYGDRMDLSSITDPLIK-----------STILGFVSNFGQVPKQLFTKPHPARTAAGKPLPG 2870

  Fly    77 DKTLAITDGSATDAASGAGSLVKYN-AGARPAEKTAPLVTGTHTSLVRASLANSNADMSANGAIA 140
                  .|.|...:..|......|: ...||::.|           |:.....|....|..||| 
Human  2871 ------KDVSTPVSLPGHPQPFFYSLQSLRPSQVT-----------VKDMYLFSLGSESPKGAI- 2917

  Fly   141 SHLQLIPKKAPSIPK------PKWHA--PW---------------KLSRVISGHLGWVRCI-AVE 181
            .|:....|...::.:      |.|:.  .|               |:.........|.||: ||.
Human  2918 GHIVSTEKTILAVERNKVLLPPLWNRTFSWGFDDFSCCLGSYGSDKVLMTFENLAAWGRCLCAVC 2982

  Fly   182 PGNEWFATGAGDRVIKIWDLASGK-------LKLSLTGHVSTVRGVAVSTKHPYLFSCGEDRQVK 239
            |......|.....|:.:|:|:..|       |:.:|.||...|..:|.|.....|.|..:|....
Human  2983 PSPTTIVTSGTSTVVCVWELSMTKGRPRGLRLRQALYGHTQAVTCLAASVTFSLLVSGSQDCTCI 3047

  Fly   240 CWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLAT--SGRDSTARIWDMRTK--ANVHTLTGHTNT 300
            .|||::...:.....|...:.::.:.   ||..|  |...:...:|::..:  |::.|..|....
Human  3048 LWDLDHLTHVTRLPAHREGISAITIS---DVSGTIVSCAGAHLSLWNVNGQPLASITTAWGPEGA 3109

  Fly   301 VASVV-----AQATNPQIITGSHDSTVRLW 325
            :....     |..|:..|||||.|..||:|
Human  3110 ITCCCLMEGPAWDTSQIIITGSQDGMVRVW 3139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 46/197 (23%)
WD40 164..458 CDD:238121 44/179 (25%)
WD40 repeat 177..212 CDD:293791 11/42 (26%)
WD40 repeat 218..254 CDD:293791 8/35 (23%)
WD40 repeat 259..295 CDD:293791 7/39 (18%)
WD40 repeat 302..337 CDD:293791 11/29 (38%)
WD40 repeat 343..378 CDD:293791
WD40 repeat 386..426 CDD:293791
WD40 repeat 433..457 CDD:293791
WDFY4XP_011538288.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.