DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and ciao1

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_012814508.1 Gene:ciao1 / 549641 XenbaseID:XB-GENE-1010751 Length:334 Species:Xenopus tropicalis


Alignment Length:260 Identity:69/260 - (26%)
Similarity:113/260 - (43%) Gaps:66/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 LFSCGEDRQVKCWDLE-YNKVIRHY--HGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKAN 290
            |.|||.||.::.|..: .|.|.:..  .||...|..::..|..:.||::..|:|..|| |:.|..
 Frog    31 LASCGGDRTIRIWGKDGDNWVCKSVLGEGHQRTVRKVSWSPCGNYLASASFDATTCIW-MKKKEE 94

  Fly   291 ---VHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKS---VCTLTNHKKSVRSIVLH 349
               :.||.||.|.|.||....:...:.|.|.|.:|.:|::...:.   |..|.:|.:.|:.:|.|
 Frog    95 FECITTLEGHENEVKSVAWAPSGSLLATCSRDKSVWVWEVDEEEEYECVSVLNSHTQDVKHVVWH 159

  Fly   350 PSLYMFASAS-PDNIKQWRCPEGKFV--QNISGHTSIVNCMAANSEGVLVSGGDNGTMFFWDWRT 411
            |:..:.|||| .|::|.:|..|..:|  ..:.||||.|                        |  
 Frog   160 PNQELLASASYDDSVKLYREEEDDWVCCATLEGHTSTV------------------------W-- 198

  Fly   412 GYNFQRFQAPVQPGSMDSEAGIFAMCFDQSGSRLITAEADKTIKVYKE---DDEASEESHPINWR 473
                                   ::.|||:|.:|.|...|||::::::   .::...:|.| ||:
 Frog   199 -----------------------SLAFDQTGEQLATCSDDKTVRIWRQLGTGEQVGSKSDP-NWK 239

  Fly   474  473
             Frog   240  239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 65/240 (27%)
WD40 164..458 CDD:238121 65/240 (27%)
WD40 repeat 177..212 CDD:293791
WD40 repeat 218..254 CDD:293791 9/27 (33%)
WD40 repeat 259..295 CDD:293791 11/38 (29%)
WD40 repeat 302..337 CDD:293791 8/37 (22%)
WD40 repeat 343..378 CDD:293791 13/37 (35%)
WD40 repeat 386..426 CDD:293791 1/39 (3%)
WD40 repeat 433..457 CDD:293791 9/23 (39%)
ciao1XP_012814508.1 WD40 17..329 CDD:238121 69/260 (27%)
WD40 repeat 19..59 CDD:293791 9/27 (33%)
WD40 22..>332 CDD:225201 69/260 (27%)
WD40 repeat 65..103 CDD:293791 11/38 (29%)
WD40 repeat 108..147 CDD:293791 9/38 (24%)
WD40 repeat 154..191 CDD:293791 12/36 (33%)
WD40 repeat 197..245 CDD:293791 15/93 (16%)
WD40 repeat 252..292 CDD:293791
WD40 repeat 303..328 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.