Sequence 1: | NP_572778.1 | Gene: | Tango4 / 32168 | FlyBaseID: | FBgn0030365 | Length: | 482 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012814508.1 | Gene: | ciao1 / 549641 | XenbaseID: | XB-GENE-1010751 | Length: | 334 | Species: | Xenopus tropicalis |
Alignment Length: | 260 | Identity: | 69/260 - (26%) |
---|---|---|---|
Similarity: | 113/260 - (43%) | Gaps: | 66/260 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 229 LFSCGEDRQVKCWDLE-YNKVIRHY--HGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKAN 290
Fly 291 ---VHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKS---VCTLTNHKKSVRSIVLH 349
Fly 350 PSLYMFASAS-PDNIKQWRCPEGKFV--QNISGHTSIVNCMAANSEGVLVSGGDNGTMFFWDWRT 411
Fly 412 GYNFQRFQAPVQPGSMDSEAGIFAMCFDQSGSRLITAEADKTIKVYKE---DDEASEESHPINWR 473
Fly 474 473 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tango4 | NP_572778.1 | WD40 | <161..458 | CDD:225201 | 65/240 (27%) |
WD40 | 164..458 | CDD:238121 | 65/240 (27%) | ||
WD40 repeat | 177..212 | CDD:293791 | |||
WD40 repeat | 218..254 | CDD:293791 | 9/27 (33%) | ||
WD40 repeat | 259..295 | CDD:293791 | 11/38 (29%) | ||
WD40 repeat | 302..337 | CDD:293791 | 8/37 (22%) | ||
WD40 repeat | 343..378 | CDD:293791 | 13/37 (35%) | ||
WD40 repeat | 386..426 | CDD:293791 | 1/39 (3%) | ||
WD40 repeat | 433..457 | CDD:293791 | 9/23 (39%) | ||
ciao1 | XP_012814508.1 | WD40 | 17..329 | CDD:238121 | 69/260 (27%) |
WD40 repeat | 19..59 | CDD:293791 | 9/27 (33%) | ||
WD40 | 22..>332 | CDD:225201 | 69/260 (27%) | ||
WD40 repeat | 65..103 | CDD:293791 | 11/38 (29%) | ||
WD40 repeat | 108..147 | CDD:293791 | 9/38 (24%) | ||
WD40 repeat | 154..191 | CDD:293791 | 12/36 (33%) | ||
WD40 repeat | 197..245 | CDD:293791 | 15/93 (16%) | ||
WD40 repeat | 252..292 | CDD:293791 | |||
WD40 repeat | 303..328 | CDD:293791 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |