DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and PLRG1

DIOPT Version :10

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_002660.1 Gene:PLRG1 / 5356 HGNCID:9089 Length:514 Species:Homo sapiens


Alignment Length:32 Identity:8/32 - (25%)
Similarity:16/32 - (50%) Gaps:2/32 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NEVDERIAIDNRMADYQKVYCKHKP--LNECD 105
            :|.|:.......:..:|:::...||  .:|||
Human   354 SECDKCFTHKRSLRSHQRIHTGEKPYKCSECD 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 164..458 CDD:238121
WD40 repeat 177..212 CDD:293791
WD40 repeat 218..254 CDD:293791
WD40 repeat 259..295 CDD:293791
WD40 repeat 302..337 CDD:293791
WD40 repeat 343..378 CDD:293791
WD40 repeat 386..426 CDD:293791
WD40 repeat 433..457 CDD:293791
PLRG1NP_002660.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..160
WD40 196..490 CDD:238121 8/32 (25%)
WD 1 202..241
WD40 repeat 209..244 CDD:293791
WD 2 244..283
WD40 repeat 250..286 CDD:293791
WD 3 286..325
WD40 repeat 291..327 CDD:293791
WD 4 328..367 2/12 (17%)
WD40 repeat 334..369 CDD:293791 2/14 (14%)
WD 5 370..410 6/16 (38%)
WD40 repeat 375..410 CDD:293791 5/11 (45%)
WD 6 411..449
WD40 repeat 416..455 CDD:293791
WD 7 460..499
WD40 repeat 465..489 CDD:293791
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.