DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and PAFAH1B1

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_011522203.1 Gene:PAFAH1B1 / 5048 HGNCID:8574 Length:428 Species:Homo sapiens


Alignment Length:434 Identity:106/434 - (24%)
Similarity:179/434 - (41%) Gaps:68/434 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KIGEARKASGAQTPGDKTLAITDGSATDAASGAGSLVKYNAGARPAE----KTAPLVTGTHTSLV 122
            |..|||..           ||.|...::....|.|:.|..|.....|    |.|.|:....||::
Human    24 KADEARNR-----------AIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVI 77

  Fly   123 R---------ASLANSNADMSANGAIASHLQLIPKKAPS--IPKPKWHAPWKLSRVISGHLGWVR 176
            |         :.|..:..:.::.|.:..      |:.|.  ||:|    |.|.:  :|||...|.
Human    78 RLQKKVMELESKLNEAKEEFTSGGPLGQ------KRDPKEWIPRP----PEKYA--LSGHRSPVT 130

  Fly   177 CIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKHPYLFSCGEDRQVKCW 241
            .:...|......:.:.|..||:||..:|..:.:|.||..:|:.::.......|.||..|..:|.|
Human   131 RVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLW 195

  Fly   242 DLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGHTNTVASVVA 306
            |.:..:.||..|||...|.|:|:.|..|.:.::.||.|.::|:::|...|.|.|||...|..|..
Human   196 DFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRP 260

  Fly   307 QATNPQIITGSHDSTVRLWDLAAGKSVCTLTNHKKSVRSIVL---------------------HP 350
            ......|.:.|:|.|||:|.:|..:....|..|:..|..|..                     .|
Human   261 NQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKP 325

  Fly   351 SLYMFASASPDNIKQWRCPEGKFVQNISGHTSIVNCMAANSEG-VLVSGGDNGTMFFWDWRTGYN 414
            ..::.:.:....||.|....|..:..:.||.:.|..:..:|.| .::|..|:.|:..||::....
Human   326 GPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRC 390

  Fly   415 FQRFQAPVQPGSMDSEAGIFAMCFDQSGSRLITAEADKTIKVYK 458
            .:...|        .|..:.::.|.::...::|...|:|:||::
Human   391 MKTLNA--------HEHFVTSLDFHKTAPYVVTGSVDQTVKVWE 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 81/318 (25%)
WD40 164..458 CDD:238121 79/315 (25%)
WD40 repeat 177..212 CDD:293791 8/34 (24%)
WD40 repeat 218..254 CDD:293791 9/35 (26%)
WD40 repeat 259..295 CDD:293791 12/35 (34%)
WD40 repeat 302..337 CDD:293791 9/34 (26%)
WD40 repeat 343..378 CDD:293791 7/55 (13%)
WD40 repeat 386..426 CDD:293791 8/40 (20%)
WD40 repeat 433..457 CDD:293791 5/23 (22%)
PAFAH1B1XP_011522203.1 LisH 30..53 CDD:285685 6/33 (18%)
WD40 115..>428 CDD:225201 82/326 (25%)
WD40 122..426 CDD:238121 79/311 (25%)
WD40 repeat 129..166 CDD:293791 9/36 (25%)
WD40 repeat 172..208 CDD:293791 9/35 (26%)
WD40 repeat 213..249 CDD:293791 12/35 (34%)
WD40 repeat 256..291 CDD:293791 9/34 (26%)
WD40 repeat 297..353 CDD:293791 7/55 (13%)
WD40 repeat 359..395 CDD:293791 8/35 (23%)
WD40 repeat 401..425 CDD:293791 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.