DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and gnb3b

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_998367.1 Gene:gnb3b / 406483 ZFINID:ZDB-GENE-040426-2280 Length:338 Species:Danio rerio


Alignment Length:392 Identity:87/392 - (22%)
Similarity:141/392 - (35%) Gaps:76/392 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GNLPEIDERLEKLRRSIKAKDGYGLVLDKVAKIGEARKASGAQTPGDKTLA-----------ITD 84
            |.:.::.:..|.|:..|:|........|..|.......|...|....|||.           .||
Zfish     2 GEMEQMKKEAEGLKTQIEAARKAAHDTDMAAAAAGVAPAPRVQLKTRKTLKGHLAKIYAMHWCTD 66

  Fly    85 GSATDAASGAGSLVKYNAGARPAEKTAPLVTGTHTSLVRASLANSNADMSANGAIASHLQLIPKK 149
            .....:||..|.|:.::|.:.......||    .:|.|.......:.::.|:|.:.:...:...|
Zfish    67 NRLMVSASQDGKLLIWDAHSGNKVNAVPL----KSSWVMTCSYAPSGNLVASGGLDNMCTVYNLK 127

  Fly   150 APSIPKPKWHAPWKLSRVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHV 214
            .|.|         |..:.:..|.|::.|.......| ..|.:||....:|||.:||.|.....|:
Zfish   128 TPVI---------KTVKELDAHTGYLSCCRFISDTE-IVTSSGDTTCALWDLETGKQKTVFLNHI 182

  Fly   215 STVRGVAVSTKHPYLFSCGEDRQVKCWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDST 279
            .               .|      .|                     |:|.|..::..:...||.
Zfish   183 G---------------DC------MC---------------------LSLSPDNNMFISGACDSL 205

  Fly   280 ARIWDMRTKANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKSVCTLTNH--KKS 342
            |::||:|......|..|||:.:.::....:....||||.|.|.:::|:.|.:.|....:.  ...
Zfish   206 AKLWDIRDGQCKQTFQGHTSDINAISFLPSATAFITGSDDCTCKMYDIRADQEVICYQDSALNSG 270

  Fly   343 VRSIVLHPS-LYMFASASPDNIKQWRCPEGKFVQNISGHTSIVNCMAANSEGVLVSGGDNGTMFF 406
            |.|:.|..| ..:||.....|...|...:|:.|..:|||.:.|:|.....:|:.|..|.      
Zfish   271 VTSVALSVSGRLIFAGYDDFNCNIWDSLKGEKVGVLSGHDNRVSCTGVPGDGMCVCTGS------ 329

  Fly   407 WD 408
            ||
Zfish   330 WD 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 59/251 (24%)
WD40 164..458 CDD:238121 58/248 (23%)
WD40 repeat 177..212 CDD:293791 11/34 (32%)
WD40 repeat 218..254 CDD:293791 2/35 (6%)
WD40 repeat 259..295 CDD:293791 10/35 (29%)
WD40 repeat 302..337 CDD:293791 9/34 (26%)
WD40 repeat 343..378 CDD:293791 10/35 (29%)
WD40 repeat 386..426 CDD:293791 6/23 (26%)
WD40 repeat 433..457 CDD:293791
gnb3bNP_998367.1 WD40 <46..338 CDD:225201 78/348 (22%)
WD40 48..338 CDD:238121 78/346 (23%)
WD40 repeat 58..95 CDD:293791 7/36 (19%)
WD40 repeat 101..139 CDD:293791 6/46 (13%)
WD40 repeat 144..179 CDD:293791 11/35 (31%)
WD40 repeat 186..221 CDD:293791 11/55 (20%)
WD40 repeat 227..263 CDD:293791 9/35 (26%)
WD40 repeat 271..307 CDD:293791 10/35 (29%)
WD40 repeat 313..337 CDD:293791 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.