DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and wdr24

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_998228.1 Gene:wdr24 / 406336 ZFINID:ZDB-GENE-040426-2012 Length:779 Species:Danio rerio


Alignment Length:385 Identity:81/385 - (21%)
Similarity:132/385 - (34%) Gaps:111/385 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 NSNADMSANGAIASHLQLIPKKAPSIPKPKWHAPWKLSR--------VISGHLGWVRCIAVEPGN 184
            |..|..:.|||:.:                    |.|||        :.:.|...|..:...|..
Zfish    82 NLLATAATNGAVVT--------------------WNLSRPCRNKQEQLFTEHKRTVNKVCFHPTE 126

  Fly   185 -EWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKHPYLFSCG-EDRQVKCWDLEY-N 246
             ....:|:.|..:|.:||...:...:.:|...:||.|..|.|..:.|:.. |:..|:.||:.. :
Zfish   127 VNMLLSGSQDGFMKCFDLRKKESVSTFSGQSESVRDVQFSMKDYFTFAASFENGNVQLWDIRRPD 191

  Fly   247 KVIRHYHGHLSAVYSLALHP-TIDVLATSGRDSTARIWDMRTK--ANVHTLTGHTNTVASVVAQA 308
            :..|.:..|...|:....|| ....|||.|||...::|||.|.  ..::.:    .|.|||....
Zfish   192 RYERMFTAHTGPVFCCDWHPEDRGWLATGGRDKMVKVWDMSTNRVKEIYCV----QTFASVARVK 252

  Fly   309 TNPQ----IITGSH--DSTVRLWDLAAG-KSVCTLTNHKKSVRSIVLHPSLYMFASASPDNIKQW 366
            ..|:    :.|.|.  |..:.:||:... ....|...||.....||                  |
Zfish   253 WRPERRYHLATCSMMVDHNIYVWDVRRPFIPFATFEEHKDVTTGIV------------------W 299

  Fly   367 RCPEGKFVQNISGHTSIVNCMAANSEGVLVSGGDNGTMFFWDWRTGYNFQRFQAPVQPGSMDSEA 431
            |.....:                    .|:||..:.|::      .:.|:....||...:.:   
Zfish   300 RHQHDPY--------------------FLLSGSKDSTLY------QHMFKDASRPVDRANPE--- 335

  Fly   432 GIFAMCFDQSG-------SRLITAEA---DKTIKVYKEDDEASEESHPINW--RPDLLKR 479
               .:||...|       ..|::|.|   |...|.|...|    ..:||.:  :||:.::
Zfish   336 ---GLCFGLFGDLAFAAKESLMSAPASAGDVGRKTYPGGD----RRYPIFFFKKPDVTEQ 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 70/327 (21%)
WD40 164..458 CDD:238121 69/324 (21%)
WD40 repeat 177..212 CDD:293791 6/35 (17%)
WD40 repeat 218..254 CDD:293791 10/37 (27%)
WD40 repeat 259..295 CDD:293791 13/38 (34%)
WD40 repeat 302..337 CDD:293791 10/41 (24%)
WD40 repeat 343..378 CDD:293791 4/34 (12%)
WD40 repeat 386..426 CDD:293791 7/39 (18%)
WD40 repeat 433..457 CDD:293791 8/33 (24%)
wdr24NP_998228.1 WD40 repeat 23..70 CDD:293791
WD40 51..>318 CDD:225201 64/297 (22%)
WD 1 66..106 9/43 (21%)
WD40 82..318 CDD:295369 64/297 (22%)
WD 2 112..152 8/39 (21%)
WD40 repeat 118..155 CDD:293791 6/36 (17%)
WD 3 155..195 11/39 (28%)
WD40 repeat 160..197 CDD:293791 11/36 (31%)
WD 4 199..239 14/39 (36%)
WD40 repeat 205..241 CDD:293791 12/35 (34%)
WD 5 243..285 10/41 (24%)
WD40 repeat 248..288 CDD:293791 8/39 (21%)
WD 6 289..332 13/86 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 506..526
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 570..590
Zn_ribbon_17 <718..776 CDD:305234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.