DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and nup43

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_998057.1 Gene:nup43 / 405828 ZFINID:ZDB-GENE-040426-2533 Length:372 Species:Danio rerio


Alignment Length:242 Identity:58/242 - (23%)
Similarity:100/242 - (41%) Gaps:32/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 ATGAGDRVIKIWDLASGKLKLSLTGHV---------STVRGVAVSTKHPYLFSCGEDRQV---KC 240
            |:.:|  .:.|:.|.|....||| .||         :.....|:..:.|.:.|.|||.:|   |.
Zfish    91 ASSSG--AVSIFKLQSDCQALSL-AHVWERAHRCSCNNAPCTAIVCRSPEIVSVGEDGRVILYKA 152

  Fly   241 WDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMR----TKANVHTLTGHTNTV 301
            ...|..:||.  :...|.::::....|.:|| |.......::||.|    :.|.:.:|||....:
Zfish   153 DQAEVTRVIE--NADSSTIHAVTFLRTTEVL-TVNSIGQLKMWDFRQQSDSPAQILSLTGDRMPL 214

  Fly   302 ASVVAQATNPQII-TGSHDSTVRLWDLAAGKSVCTLTN-HKKSVRSIVLHPS--LYMFASASPDN 362
            ..|........|: ||..|..:.:||:..|.:..:||. |...:..:..|||  .::|..:...:
Zfish   215 HCVDKHPNQQHIVATGGQDGMLCIWDVRQGNTPFSLTEAHSAEMWEVHFHPSNPNHLFTCSEDGS 279

  Fly   363 IKQWRCPEGKFVQNI--SGHTSIVNCMAANSEGVLVSGGDNGTMFFW 407
            :..|....|..|..:  .|..|.|...:|.|    ::|.::..:..|
Zfish   280 LLHWESTSGSDVSTLLQKGWNSRVVSQSALS----LAGENDSAVSAW 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 58/242 (24%)
WD40 164..458 CDD:238121 58/242 (24%)
WD40 repeat 177..212 CDD:293791 8/23 (35%)
WD40 repeat 218..254 CDD:293791 11/38 (29%)
WD40 repeat 259..295 CDD:293791 8/39 (21%)
WD40 repeat 302..337 CDD:293791 8/35 (23%)
WD40 repeat 343..378 CDD:293791 7/38 (18%)
WD40 repeat 386..426 CDD:293791 4/22 (18%)
WD40 repeat 433..457 CDD:293791
nup43NP_998057.1 WD40 73..>294 CDD:295369 51/208 (25%)
WD40 repeat 78..122 CDD:293791 10/33 (30%)
WD40 <138..361 CDD:225201 46/192 (24%)
WD40 repeat 170..209 CDD:293791 9/39 (23%)
WD40 repeat 214..251 CDD:293791 8/36 (22%)
WD40 repeat 259..294 CDD:293791 7/34 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.