Sequence 1: | NP_572778.1 | Gene: | Tango4 / 32168 | FlyBaseID: | FBgn0030365 | Length: | 482 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261750.1 | Gene: | thoc6 / 39394 | FlyBaseID: | FBgn0036263 | Length: | 350 | Species: | Drosophila melanogaster |
Alignment Length: | 208 | Identity: | 44/208 - (21%) |
---|---|---|---|
Similarity: | 70/208 - (33%) | Gaps: | 82/208 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 242 DLEYNKVIRHYH----GHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTL-------- 294
Fly 295 --------------------------------TGHTNTVASVVAQATNPQIITGSHDSTVRLWDL 327
Fly 328 AAGKSVCTLTNHKKSVRSIVLHPSLYMFASASPDNIKQWRCPEGKFVQNISGHTSIVNCMAANSE 392
Fly 393 GVLVSGGDNGTMF 405 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tango4 | NP_572778.1 | WD40 | <161..458 | CDD:225201 | 44/208 (21%) |
WD40 | 164..458 | CDD:238121 | 44/208 (21%) | ||
WD40 repeat | 177..212 | CDD:293791 | |||
WD40 repeat | 218..254 | CDD:293791 | 3/15 (20%) | ||
WD40 repeat | 259..295 | CDD:293791 | 8/75 (11%) | ||
WD40 repeat | 302..337 | CDD:293791 | 13/34 (38%) | ||
WD40 repeat | 343..378 | CDD:293791 | 7/34 (21%) | ||
WD40 repeat | 386..426 | CDD:293791 | 6/20 (30%) | ||
WD40 repeat | 433..457 | CDD:293791 | |||
thoc6 | NP_001261750.1 | WD40 | <45..325 | CDD:225201 | 44/208 (21%) |
WD40 | <115..265 | CDD:295369 | 32/148 (22%) | ||
WD40 repeat | 159..194 | CDD:293791 | 14/35 (40%) | ||
WD40 repeat | 209..244 | CDD:293791 | 6/22 (27%) | ||
WD40 repeat | 249..280 | CDD:293791 | |||
WD40 repeat | 286..320 | CDD:293791 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |