DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and thoc6

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001261750.1 Gene:thoc6 / 39394 FlyBaseID:FBgn0036263 Length:350 Species:Drosophila melanogaster


Alignment Length:208 Identity:44/208 - (21%)
Similarity:70/208 - (33%) Gaps:82/208 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 DLEYNKVIRHYH----GHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTL-------- 294
            |::.|.:..|..    |.:..:|.|..:...:.|||.      |.|:::....|..:        
  Fly    61 DVDINYLAFHRDFLIVGAVGLIYGLEWNEEEESLATK------RSWEVKIPMQVDAVEVPDVNSM 119

  Fly   295 --------------------------------TGHTNTVASVVAQATNPQIITGSHDSTVRLWDL 327
                                            .|||:.|.|||..| |.||.:|:.|.|||:|..
  Fly   120 WLDSENSILFAGCGDGVIYQVSLEDGRIQREYRGHTDYVHSVVGNA-NGQIFSGAEDGTVRVWST 183

  Fly   328 AAGKSVCTLTNHKKSVRSIVLHPSLYMFASASPDNIKQWRCPEGKFVQNISGHTSIVNCMAANSE 392
            ...:....|..:|        :|:|     ..||    |    ||:          :..:|.|.:
  Fly   184 KQQQHTSMLEPYK--------NPNL-----LRPD----W----GKW----------IGAVAVNED 217

  Fly   393 GVLVSGGDNGTMF 405
            .:|..||...::|
  Fly   218 WLLCGGGPKASIF 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 44/208 (21%)
WD40 164..458 CDD:238121 44/208 (21%)
WD40 repeat 177..212 CDD:293791
WD40 repeat 218..254 CDD:293791 3/15 (20%)
WD40 repeat 259..295 CDD:293791 8/75 (11%)
WD40 repeat 302..337 CDD:293791 13/34 (38%)
WD40 repeat 343..378 CDD:293791 7/34 (21%)
WD40 repeat 386..426 CDD:293791 6/20 (30%)
WD40 repeat 433..457 CDD:293791
thoc6NP_001261750.1 WD40 <45..325 CDD:225201 44/208 (21%)
WD40 <115..265 CDD:295369 32/148 (22%)
WD40 repeat 159..194 CDD:293791 14/35 (40%)
WD40 repeat 209..244 CDD:293791 6/22 (27%)
WD40 repeat 249..280 CDD:293791
WD40 repeat 286..320 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.